Spandidos Publications Logo
  • About
    • About Spandidos
    • Aims and Scopes
    • Abstracting and Indexing
    • Editorial Policies
    • Reprints and Permissions
    • Job Opportunities
    • Terms and Conditions
    • Contact
  • Journals
    • All Journals
    • Oncology Letters
      • Oncology Letters
      • Information for Authors
      • Editorial Policies
      • Editorial Board
      • Aims and Scope
      • Abstracting and Indexing
      • Bibliographic Information
      • Archive
    • International Journal of Oncology
      • International Journal of Oncology
      • Information for Authors
      • Editorial Policies
      • Editorial Board
      • Aims and Scope
      • Abstracting and Indexing
      • Bibliographic Information
      • Archive
    • Molecular and Clinical Oncology
      • Molecular and Clinical Oncology
      • Information for Authors
      • Editorial Policies
      • Editorial Board
      • Aims and Scope
      • Abstracting and Indexing
      • Bibliographic Information
      • Archive
    • Experimental and Therapeutic Medicine
      • Experimental and Therapeutic Medicine
      • Information for Authors
      • Editorial Policies
      • Editorial Board
      • Aims and Scope
      • Abstracting and Indexing
      • Bibliographic Information
      • Archive
    • International Journal of Molecular Medicine
      • International Journal of Molecular Medicine
      • Information for Authors
      • Editorial Policies
      • Editorial Board
      • Aims and Scope
      • Abstracting and Indexing
      • Bibliographic Information
      • Archive
    • Biomedical Reports
      • Biomedical Reports
      • Information for Authors
      • Editorial Policies
      • Editorial Board
      • Aims and Scope
      • Abstracting and Indexing
      • Bibliographic Information
      • Archive
    • Oncology Reports
      • Oncology Reports
      • Information for Authors
      • Editorial Policies
      • Editorial Board
      • Aims and Scope
      • Abstracting and Indexing
      • Bibliographic Information
      • Archive
    • Molecular Medicine Reports
      • Molecular Medicine Reports
      • Information for Authors
      • Editorial Policies
      • Editorial Board
      • Aims and Scope
      • Abstracting and Indexing
      • Bibliographic Information
      • Archive
    • World Academy of Sciences Journal
      • World Academy of Sciences Journal
      • Information for Authors
      • Editorial Policies
      • Editorial Board
      • Aims and Scope
      • Abstracting and Indexing
      • Bibliographic Information
      • Archive
    • International Journal of Functional Nutrition
      • International Journal of Functional Nutrition
      • Information for Authors
      • Editorial Policies
      • Editorial Board
      • Aims and Scope
      • Abstracting and Indexing
      • Bibliographic Information
      • Archive
    • International Journal of Epigenetics
      • International Journal of Epigenetics
      • Information for Authors
      • Editorial Policies
      • Editorial Board
      • Aims and Scope
      • Abstracting and Indexing
      • Bibliographic Information
      • Archive
    • Medicine International
      • Medicine International
      • Information for Authors
      • Editorial Policies
      • Editorial Board
      • Aims and Scope
      • Abstracting and Indexing
      • Bibliographic Information
      • Archive
  • Articles
  • Information
    • Information for Authors
    • Information for Reviewers
    • Information for Librarians
    • Information for Advertisers
    • Conferences
  • Language Editing
Spandidos Publications Logo
  • About
    • About Spandidos
    • Aims and Scopes
    • Abstracting and Indexing
    • Editorial Policies
    • Reprints and Permissions
    • Job Opportunities
    • Terms and Conditions
    • Contact
  • Journals
    • All Journals
    • Biomedical Reports
      • Information for Authors
      • Editorial Policies
      • Editorial Board
      • Aims and Scope
      • Abstracting and Indexing
      • Bibliographic Information
      • Archive
    • Experimental and Therapeutic Medicine
      • Information for Authors
      • Editorial Policies
      • Editorial Board
      • Aims and Scope
      • Abstracting and Indexing
      • Bibliographic Information
      • Archive
    • International Journal of Epigenetics
      • Information for Authors
      • Editorial Policies
      • Editorial Board
      • Aims and Scope
      • Abstracting and Indexing
      • Bibliographic Information
      • Archive
    • International Journal of Functional Nutrition
      • Information for Authors
      • Editorial Policies
      • Editorial Board
      • Aims and Scope
      • Abstracting and Indexing
      • Bibliographic Information
      • Archive
    • International Journal of Molecular Medicine
      • Information for Authors
      • Editorial Policies
      • Editorial Board
      • Aims and Scope
      • Abstracting and Indexing
      • Bibliographic Information
      • Archive
    • International Journal of Oncology
      • Information for Authors
      • Editorial Policies
      • Editorial Board
      • Aims and Scope
      • Abstracting and Indexing
      • Bibliographic Information
      • Archive
    • Medicine International
      • Information for Authors
      • Editorial Policies
      • Editorial Board
      • Aims and Scope
      • Abstracting and Indexing
      • Bibliographic Information
      • Archive
    • Molecular and Clinical Oncology
      • Information for Authors
      • Editorial Policies
      • Editorial Board
      • Aims and Scope
      • Abstracting and Indexing
      • Bibliographic Information
      • Archive
    • Molecular Medicine Reports
      • Information for Authors
      • Editorial Policies
      • Editorial Board
      • Aims and Scope
      • Abstracting and Indexing
      • Bibliographic Information
      • Archive
    • Oncology Letters
      • Information for Authors
      • Editorial Policies
      • Editorial Board
      • Aims and Scope
      • Abstracting and Indexing
      • Bibliographic Information
      • Archive
    • Oncology Reports
      • Information for Authors
      • Editorial Policies
      • Editorial Board
      • Aims and Scope
      • Abstracting and Indexing
      • Bibliographic Information
      • Archive
    • World Academy of Sciences Journal
      • Information for Authors
      • Editorial Policies
      • Editorial Board
      • Aims and Scope
      • Abstracting and Indexing
      • Bibliographic Information
      • Archive
  • Articles
  • Information
    • For Authors
    • For Reviewers
    • For Librarians
    • For Advertisers
    • Conferences
  • Language Editing
Login Register Submit
  • This site uses cookies
  • You can change your cookie settings at any time by following the instructions in our Cookie Policy. To find out more, you may read our Privacy Policy.

    I agree
Search articles by DOI, keyword, author or affiliation
Search
Advanced Search
presentation
Molecular Medicine Reports
Join Editorial Board Propose a Special Issue
Print ISSN: 1791-2997 Online ISSN: 1791-3004
Journal Cover
June-2017 Volume 15 Issue 6

Full Size Image

Sign up for eToc alerts
Recommend to Library

Journals

International Journal of Molecular Medicine

International Journal of Molecular Medicine

International Journal of Molecular Medicine is an international journal devoted to molecular mechanisms of human disease.

International Journal of Oncology

International Journal of Oncology

International Journal of Oncology is an international journal devoted to oncology research and cancer treatment.

Molecular Medicine Reports

Molecular Medicine Reports

Covers molecular medicine topics such as pharmacology, pathology, genetics, neuroscience, infectious diseases, molecular cardiology, and molecular surgery.

Oncology Reports

Oncology Reports

Oncology Reports is an international journal devoted to fundamental and applied research in Oncology.

Experimental and Therapeutic Medicine

Experimental and Therapeutic Medicine

Experimental and Therapeutic Medicine is an international journal devoted to laboratory and clinical medicine.

Oncology Letters

Oncology Letters

Oncology Letters is an international journal devoted to Experimental and Clinical Oncology.

Biomedical Reports

Biomedical Reports

Explores a wide range of biological and medical fields, including pharmacology, genetics, microbiology, neuroscience, and molecular cardiology.

Molecular and Clinical Oncology

Molecular and Clinical Oncology

International journal addressing all aspects of oncology research, from tumorigenesis and oncogenes to chemotherapy and metastasis.

World Academy of Sciences Journal

World Academy of Sciences Journal

Multidisciplinary open-access journal spanning biochemistry, genetics, neuroscience, environmental health, and synthetic biology.

International Journal of Functional Nutrition

International Journal of Functional Nutrition

Open-access journal combining biochemistry, pharmacology, immunology, and genetics to advance health through functional nutrition.

International Journal of Epigenetics

International Journal of Epigenetics

Publishes open-access research on using epigenetics to advance understanding and treatment of human disease.

Medicine International

Medicine International

An International Open Access Journal Devoted to General Medicine.

Journal Cover
June-2017 Volume 15 Issue 6

Full Size Image

Sign up for eToc alerts
Recommend to Library

  • Article
  • Citations
    • Cite This Article
    • Download Citation
    • Create Citation Alert
    • Remove Citation Alert
    • Cited By
  • Similar Articles
    • Related Articles (in Spandidos Publications)
    • Similar Articles (Google Scholar)
    • Similar Articles (PubMed)
  • Download PDF
  • Download XML
  • View XML
Article

Relationship between T-cell receptor beta chain sequences and human cytomegalovirus infection in allogeneic hematopoietic stem cell transplant recipients

  • Authors:
    • Zhihua Wu
    • Huiping Zhang
    • Min Jin
    • Hanying Liang
    • Yaping Huang
    • Rong Yang
    • Genyong Gui
    • Huiqi Wang
    • Shengnan Gong
    • Jindong Wang
    • Jun Fan
  • View Affiliations / Copyright

    Affiliations: Virology Department, State Key Laboratory for Diagnosis and Treatment of Infectious Diseases, Collaborative Innovation Center for Diagnosis and Treatment of Infectious Diseases, The First Affiliated Hospital, College of Medicine, Zhejiang University, Hangzhou, Zhejiang 310003, P.R. China, Department of Clinical Laboratory, Hangzhou Cancer Hospital, Hangzhou, Zhejiang 310002, P.R. China
  • Pages: 3898-3904
    |
    Published online on: April 11, 2017
       https://doi.org/10.3892/mmr.2017.6453
  • Expand metrics +
Metrics: Total Views: 0 (Spandidos Publications: | PMC Statistics: )
Metrics: Total PDF Downloads: 0 (Spandidos Publications: | PMC Statistics: )
Cited By (CrossRef): 0 citations Loading Articles...

This article is mentioned in:



Abstract

In the present study, clonal amplifications of T-cell receptor β variable (TCR BV) linked to human cytomegalovirus (HCMV) infection were detected in recipients of allogeneic hematopoietic stem cell transplants (HSCT), and certain relationships between them were identified. Furthermore, the relationship between TCR BV sequences and HCMV infections was investigated. The results indicated that the 3 recipients of HSCT had monoclonal expansion of specific TCR BV clones following HSCT. Among these recipients, 2 suffered from pp65 and immediate early (IE) antigenemia. These patients demonstrated preferential expansion of TCR BV9 (QVRGGTDTQ) and TCR BV11 (VATDFQ). The remaining recipient did not express TCR BV9 and TCR BV11, nor did this individual have pp65 and IE antigenemia. These results suggest that expression of TCR BV9 and TCR BV11 may be associated with HCMV antigenemia, and may be involved in the immune response. The amino acid sequences ‘QVRGGTDTQ’ and ‘VATDFQ’ may be involved in HCMV reactivation in patients who have undergone HSCT. Assessment of the TCR BV families may provide valuable insight into HCMV pathogenesis and may aid in the diagnosis and therapy for HSCT recipients infected with HCMV.

Introduction

Human cytomegalovirus (HCMV) infection is a major cause of high morbidity and mortality in patients that have undergone allogeneic hematopoietic stem cell transplantation (HSCT) (1,2). Cellular immunity through antigen-specific cytotoxic T lymphocytes (CTLs) is involved in long-term suppression (3,4). Each individual CTL has a specific complementarity determining region 3 (CDR3) located in the T cell receptor β variable (TCR BV) region, which occurs as a result of V(D)J recombination and junctional diversity. During an antiviral immune response, the interactions between a TCR and its antigen-specific peptides, which are mediated in part by CDR3, result in a polyclonal expansion of T cells and clones expressing different CDR3 sequences (5). Determining the frequency of specific CDR3 sequences within a T-cell population may provide an accurate estimation of the extent of clonal expansion and the function of the expanded populations. It is well-known that TCRs are closely associated with viral infections, specifically hepatitis B virus (HBV) and human immunodeficiency virus (HIV) (6,7). The occurrence of HCMV reactivation in patients following HSCT is also well documented (8,9). However, the underlying mechanisms responsible for this reactivation remain unknown. In the present study, reverse transcription-quantitative polymerase chain reaction (RT-qPCR) and DNA melting curve analysis were used to evaluate the distribution of TCR BV CDR3 genes expressed in peripheral blood mononuclear cells (PBMCs) isolated from patients that had undergone HSCT. This analysis evaluated the impact of T-cells on HCMV reactivation beyond T cell clonal expansion, thus providing molecular evidence that an association exists between HCMV infection and immune dysregulation in patients following HSCT.

Materials and methods

Subjects

A total of 3 HSCT recipients at The First Affiliated Hospital, Zhejiang University School of Medicine (Hangzhou, China) were enrolled in the present study between January 2011 and December 2012. One healthy donor from the same hospital was enrolled as a control, in December 2012. Patients with the following viral infections were excluded from this study: HIV, HBV, hepatitis A virus, hepatitis C virus, hepatitis D virus, hepatitis E virus, herpes simplex virus, and Epstein-Barr virus. Recipient 1 was not infected with HCMV, while repeated HCMV reactivation occurred in recipients 2 and 3. Additional patient information is listed in Table I. The present study was approved by the Ethics Committee of the First Affiliated Hospital at the Medical School of Zhejiang University (Hangzhou, China). Written, informed consent was obtained from patients according to the Declaration of Helsinki.

Table I.

Characteristics of recipients and the healthy control.

Table I.

Characteristics of recipients and the healthy control.

General informationRecipient1Recipient 2Recipient 3Healthy control
SexFemaleFemaleMaleMale
Age31242025
Underlying diseaseCMLAMMOL(M4)ALLNone
HIV−−−−
HSV−−−−
HAV−−−−
HBV−−−−
HCV−−−−
HDV−−−−
HEV−−−−
EBV−−−−
HCMV-IgG++++
Conditioning regimen ARA-C+BUCY+Me-CCNU+ATG ARA-C+BUCY+ATG+MeCCNUBUCY+MeCCNUN/A
Blood typeB/BB/BB/BB
HLAHLA0201HLA0201HLA0201HLA0201
Immunosuppressant regimenCSA, MMF, PREDCSA, MMF, PREDCSA, MMF, PREDN/A
Antiviral pretreatmentGCV, ACVGCV, ACVGCV, ACVN/A

[i] CML, chronic myelogenous leukemia; ALL, acute lymphocytic leukemia; AMMOL, acute myelomonocytic leukemia; HLA, human leukocyte antigen; GCV, ganciclovir; ACV, acyclovir; CSA, cyclosporin A; MMF, mycophenolate mofetil; PRED, prednisone; ARA-C, cytosine arabinoside; BU, busulfan; CY, cyclophosphamide; MeCCNU, methyl-cyclohexyl-nitrosamine; ATG, anti-thymocyte globulin; N/A, not applicable.

TCR BV CDR3 genes expressed in PBMCs from all subjects were detected using RT-qPCR and a DNA melting curve analysis at the third month after transplantation (10,11). HCMV-pp65, HCMV-immediate early protein (HCMV-IE), HCMV-immunoglobulin (HCMV-Ig) M and HCMV-IgG were detected on the same day, and serial analysis of HCMV infection continued monthly until ~1 year after HSCT.

RNA extraction and cDNA synthesis

A total of 5 ml blood was collected from each subject, and PBMCs were isolated using a Ficoll-Paque density gradient technique. Total RNA was extracted using TRNzol reagent (Tiangen Biotech Co., Ltd., Beijing, China), according to the manufacturer's protocol. Total RNA was reverse transcribed to cDNA using a RevertAid First Strand cDNA Synthesis kit (Thermo Fisher Scientific, Inc., Waltham, MA, USA) according to the manufacturer's protocol. Sample RNA of 1–5 µg was reverse transcribed with the OligodT18 primer in a 20 µl reaction volume and stored at −80°C prior to being used as the template for PCR amplification.

RT-qPCR amplification of CDR3 cDNA

In this study, we used primers for 24 TCR BV gene families (Table II) (12). A TransStart TM Green qPCR Super Mix (Tiangen Biotech Co., Ltd., Beijing, China) was used for qPCR. PCR reactions contained 0.5 µl reverse primer (TCR BV), 0.5 µl forward primer (24 TCR BV genes), 1 µl template cDNA, 12.5 µl qPCR Super Mix (2X), 0.5 µl passive reference (50X), and 10 µl RNase-free distilled water, to a final volume of 25 µl. Reactions were performed using an ABI 7500 system and were analyzed with v2.0.6 software (Applied Biosystems; Thermo Fisher Scientific, Inc.). The reaction parameters were as follows: 2 min at 94°C to activate the GoTaq DNA polymerase enzyme (Promega Corporation, Madison, WI, USA), followed by 45 cycles at 94°C for 15 sec, 56.0°C for 25 sec, 72°C for 35 sec, 80°C for 2 sec, and a final extension at 72°C for 8 min. The melting step was performed by slow heating from 75 to 95°C with a ramping rate of 0.2°C/s, during which the fluorescence signal was continuously measured. Simultaneous amplification of TCR β chain constant 1 and glyceraldehyde 3-phosphate dehydrogenase were used as positive controls.

Table II.

Primers of 24 TCR BV families and GAPDH.

Table II.

Primers of 24 TCR BV families and GAPDH.

Name of primerSequence (5′-3′)V region to CDR3
BV1 gcacaacagttccctgacttgcac  90 bp
BV2 tcatcaaccatgcaagcctgacct  90 bp
BV3 gtctctagagagaagaaggagcgc  91 bp
BV4 acatatgagagtggatttgtcatt124 bp
BV5.1 atacttcagtgagacacagagaaac142 bp
BV5.2 ttccctaactatagctctgagctg  81 bp
BV6 aggcctgagggatccgtctc  85 bp
BV7 cctgaatgccccaacagctctc  91 bp
BV8 atttactttaacaacaacgttccg128 bp
BV9 cctaaatctccagacaaagctcac  91 bp
BV10 ctccaaaaactcatcctgtacctt  83 bp
BV11 tcaacagtctccagaataaggacg  97 bp
BV12 aaaggagaagtctcagat118 bp
BV13.1 caaggagaagtccccaat118 bp
BV13.2 ggtgagggtacaactgcc136 bp
BV14 gtctctcgaaaagagaagaggaat  91 bp
BV15 agtgtctctcgacaggcacaggct  95 bp
BV16 aaagagtctaaacaggatgagtcc139 bp
BV17 cagatagtaaatgactttcag139 bp
BV18 gatgagtcaggaatgccaaaggaa124 bp
BV19 caatgccccaagaacgcaccctgc  88 bp
BV20 agctctgaggtgccccagaatctc−131 bpa
BV21 gattcacagttgcctaagga121 bp
BV22 cagagaagtctgaaatattcga128 bp
BV23 gatcgattctcagctcaacag103 bp
BV24 aaagattttaacaatgaagcagac133 bp
TCR BC1 anti-sense ttctgatggctcaaacac
GAPDH anti-sense aggggtctacatggcaact
GAPDH sense cgaccactttgtcaagctca227 bp (predicted size)

a TCR BV20 was behind the TCR BC gene in the human TCR genome, so it was designated −131 bp. TCR BV, T-cell receptor β variable; TCR BC1, TCR β chain constant 1; GAPDH, glyceraldehyde 3-phosphate dehydrogenase.

CDR3 sequencing of monoclonal TCR BV families

Using this melting curve, PCR products from the TCR BV gene families that had a single-peak expansion were selected. Single-peak expansion was defined as ‘monoclonal’, and appeared as only one main peak in the gene melting spectral pattern (GMSP). ‘Nonskewed’ means polyclonal amplification, which appeared as no visibly apparent main peak. The PCR products were re-amplified using GoTaq DNA polymerase (Promega Corporation, Madison, WI, USA) by touchdown PCR. The parameters were as follows: pre-incubation at 95°C for 2 min, 95°C for 30 sec, 58.5°C for 40 sec and 72°C for 45 sec, and 6 cycles with annealing temperature decreasing 0.5°C per cycle, followed by 34 cycles of 95°C for 45 sec, 56°C for 45 sec and 72°C for 45 sec. At the end, a terminal elongation step at 72°C for 8 min was added. Nested PCR products were sequenced using an ABI 3730 DNA Sequencer (Applied Biosystems; Thermo Fisher Scientific, Inc.). Samples were sent to Sangon Biotech Co., Ltd., Shanghai, China, and sequenced there. Results were analyzed automatically by a 3730xl DNA Analyzer and the sequencing reagent was BigDye terminator version 3.1.

Analysis of CDR3 sequences

Chromas software version 2.22 (Technelysium Pty Ltd., Brisbane, Australia) was used to translate nucleotide sequences into amino acid sequences (13). When the PCR nucleic acid product underwent electrophoresis and only one band was present, this represented direct sequencing. The presence of a thin strip in addition to a clear band, suggested cloned sequencing. Samples were sent to Sangon Biotech Co., Ltd., and sequenced there.

Detection of HCMV-pp65 and IE antigenemia

Peripheral blood samples were collected in ethylenediaminetetraacetic acid (EDTA)-anticoagulant tubes. To evaluate pp65 and IE antigenemia a standard two-step immunohistochemical method was used, as described previously (14,15). Briefly, 5×104 PBMCs were fixed on polylysine-coated slides, and incubated with mouse anti-HCMV (pp65 catalog no. ab53495; IE catalog no. ab53489; 1:100; Abcam, Cambridge, UK) monoclonal antibodies at 37°C for 30 min, and horseradish peroxidase-conjugated rabbit anti-mouse IgG polyclonal antibody (catalog no. ab6728; 1:250; Abcam) at 37°C for 30 min. A total of 5×104 PBMCs were fixed on one slide, and every sample was fixed on 2 slides. Results were quantified based on the average number of brown stained positive cells per 5×104 leukocytes in the 2 slides. Cells were observed under a light microscope (BH-2; Olympus Corporation, Tokyo, Japan) with magnification ×100/200/400.

Detection of HCMV-IgG/IgM

Blood samples were collected in EDTA-anticoagulant tubes. HCMV-antibody serostatus (IgG and IgM) was determined using enzyme-linked immunosorbent assays (ELISA) according to the manufacturer's protocols (Dia.Pro Diagnostic Bioprobes s.r.l., Milan, Italy).

Statistical analysis

Differences in HCMV antigenemia and the presence of HCMV-IgG/IgM among the 3 HSCT recipients were examined using one-way analysis of variance followed by Tukey's test. Graphical analyses of results were generated using Prism 5 (Graph-Pad, San Diego, CA, USA). P<0.05 was considered to indicate a statistically significant difference.

Results

Frequency of skewed TCR BV gene families and CDR3 sequences derived from monoclonal TCR BV expansion in 3 recipients of HSCT

All 3 recipients of HSCT demonstrated preferential expansion of specific TCR BV gene families. The characteristics of TCRBV CDR3 expression are visualized in Fig. 1. For recipient 1, 5 monoclonal peaks were observed and TCR BV5.1 was preferentially expressed. In recipient 2, 4 monoclonal peaks were observed, including TCR BV9, TCR BV11, and TCR BV17. In recipient 3, 10 monoclonal peaks were observed and TCR BV9, TCR BV11, and TCR BV21 were selectively expressed. Recipients 2 and 3 had 2 gene families in common; TCR BV9 and TCR BV11 (Fig. 1).

Figure 1.

Representative gene melting spectral pattern with single-peak (monoclonal expansion) for TCR BV in peripheral blood mononuclear cells from all 3 transplant recipients. The TCR BV gene families in the top graphs correspond to recipients 1 (TCR BV5.1) and 2 (TCR BV9, 11 and 17). TCR BV gene families in the bottom graphs correspond to recipient 3 (TCR BV9, TCR BV11, and TCR BV21) and the healthy control. The x-axis of each plot corresponds to the melting temperature. A decrease in fluorescence vs. temperature (derivative reporter, -RN') is plotted on the y-axis. TCR BV, T-cell receptor β variable.

A single peak in a GMSP indicates monoclonal expansion of a particular TCR BV clone, and this was verified by direct sequencing. Representative amino acid sequences of the TCR BV CDR3 in PBMCs from all recipients are listed in Table III. All recipients had a CDR3 sequence length of 5–12 amino acids. The amino acid sequences of TCR BV9 (QVRGGTDTQ) and TCR BV11 (VATDFQ) were similar between recipients 2 and 3. The healthy control expressed a non-skewed TCR BV repertoire. Representative GMSPs for non-skewed and oligoclonally expanded TCRBV gene families are visualized in Fig. 2.

Figure 2.

Representative gene melting spectral patterns of non-skewed TCR BV distributions in peripheral blood mononuclear cells from the healthy control. In total, 24 TCR BV gene families were assessed, including TCR BV5 and TCR BV13. The x-axis of each plot corresponds to the melting temperature, the decrease in fluorescence vs. temperature (derivative reporter -RN'.) is plotted on the y-axis. TCR BV, T-cell receptor β variable.

Table III.

Representative amino acid sequences of monoclonal TCRBV populations from 3 recipients of allogeneic hematopoietic stem cell transplantation.

Table III.

Representative amino acid sequences of monoclonal TCRBV populations from 3 recipients of allogeneic hematopoietic stem cell transplantation.

RecipientPrimer BVVβCDR3Jbeta
1BV5.1SALYLCASSSPRDRGYGDTQYFGPGTRLTVLED
2BV9SAVYFCASSQVRGGTDTQYFGPGTRLTVLET
BV11TSQHFCASSVATDEQFFGPGTRLTVLED
BV17TAFYLCASSIGQGNTEAFFGQGTRLTV
3BV9SAVYFCASSQVRGGTDTQYFGPGTRLTVLED
BV11TSQYLCASSVATDEQFFGPGTWLTVLED
BV21SAVYLCASSGMIGRLTDTQYFGPGTRLTVLED

[i] Polymerase chain reaction products were extracted when their gene melting spectral patterns revealed a single peak, and directly sequenced or sequenced following cloning. Amino acid sequences of TCR BV9 (QVRGGTDTQ) and TCR BV11 (VATDFQ) were similar between recipients 2 and 3. TCR BV, T-cell receptor β variable; CDR3, complementarity determining region 3.

Detection of pp65 and IE antigenemia

In all transplant recipients, pp65 and IE antigenemia were monitored ~10 times for up to one year following HSCT. Samples obtained from recipient 1 were typically pp65- and IE-negative, while recipients 2 and 3 consistently tested positive for pp65 (Fig. 3A) and IE antigenemia (Fig. 3B). For recipient 2, the mean number of pp65-positive cells was 4.5/5×104 PBMCs (range, 1–10 positive cells/5×104 PBMCs), and the mean number of IE-positive cells was 4.3/5×104 PBMCs (range, 1–9 positive cells/5×104 PBMCs). For recipient 3, a mean number of pp65-positive cells of 4.6/5×104 PBMCs (range, 2–8 positive cells/5×104 PBMCs) and a mean number of IE-positive cells of 4.2/5×104 PBMCs (range, 2–8 positive cells/5×104 PBMCs) was observed.

Figure 3.

Comparison of HCMV antigenemia levels and serostatus. Levels of (A) pp65 antigenemia, (B) IE antigenemia, (C) HCMV-IgM S/CO and (D) HCMV-IgG S/CO. S/CO, optical density of the sample/cut-off; HCMV, human cytomegalovirus; IE, immediate early; HSCT, allogeneic hematopoietic stem cell transplantation.

Detection of HCMV serostatus (IgG and IgM)

Over the course of 1 year following HSCT, HCMV-specific IgG and IgM were investigated on 10 separate occasions for all 3 recipients, during detection of pp65 and IE antigens. During the present study, all recipients remained HCMV-IgG-positive and HCMV-IgM-negative.

Analysis of HCMV-pp65 and -IE antigenemia levels

The levels of HCMV-pp65 and IE antigenemia were evaluated using a standard two-step immunohistochemical method on 60 samples from 3 recipients following HSCT. All recipients were tested on 10 separate occasions, up to one year following HSCT and all data of HCMV-pp65 or HCMV-IE collected during this period were involved. Statistically significant differences were observed in the levels of HCMV-pp65 (P<0.05; Fig. 3A) and -IE (P<0.05; Fig. 3B) antigenemia between recipients 1 and 2. This result was also observed between recipients 1 and 3 (P<0.05 and P<0.05, respectively; Fig. 3A and B, respectively). However, there was no significant difference in the levels of pp65 and IE antigenemia between recipients 2 and 3 (P>0.05 and P<0.05, respectively; Fig. 3A and B, respectively).

Comparison of the HCMV serostatus (IgG and IgM) among recipients of HSCT

HCMV-specific-IgG and IgM was detected using ELISA on 60 samples from 3 patients 1 year following HSCT. Each recipient was tested 10 times on separate occasions. During the study, all recipients remained HCMV-specific-IgG-positive and IgM-negative. No significant difference between HCMV-IgG and IgM optical density/cut-off among the 3 recipients was observed. (P>0.05).

Comparison of HCMV antigenemia levels between TCR BV9/TCR BV11-positive recipients and the TCR BV9/TCR BV11-negative recipient

Recipients who preferentially expressed TCR BV9 and TCR BV11 were defined as TCR BV9+ and TCR BV11+, respectively. Among the 3 recipients enrolled, recipients 2 and 3 were TCR BV9+/TCR BV11+. ‘QVRGGTDTQ’ was the conserved amino acid sequence in TCR BV9 CDR3 and ‘VATDFQ’ was observed in TCR BV11 CDR3 (Table III). Two recipients exhibited pp65 and IE antigenemia, while being simultaneously positive for HCMV-IgG and negative for HCMV-IgM. Recipient 1 was TCR BV9−/TCR BV11−, HCMV-IgG+ and HCMV-IgM−, but free of pp65 and IE antigenemia (Table IV). To determine whether HCMV reactivation was associated with a specific amino acid sequence of TCR BV CDR3, HCMV antigenemia status were compared between the TCR BV9+/TCR BV11+ recipients and the TCR BV9−/TCR BV11− recipient (Table IV). This revealed that HCMV reactivation may be associated with TCR BV9 and TCR BV11, and a specific amino acid sequence of TCR BV CDR3 may be involved in HCMV infection.

Table IV.

HCMV antigenemia status and TCR BV9/BV11 expression among the 3 recipients of allogeneic hematopoietic stem cell transplantation.

Table IV.

HCMV antigenemia status and TCR BV9/BV11 expression among the 3 recipients of allogeneic hematopoietic stem cell transplantation.

HCMV antigenemia

RecipientTCR BV9TCR BV11HCMV-pp65HCMV-IE
1−−−−
2++++
3++++

[i] TCR BV9/11+, recipients who preferentially expressed TCR BV9/11; TCR BV9/11−, recipients who did not express TCR BV9/11; HCMV-pp65/IE+, recipients who exhibited pp65/IE antigenemia; HCMV-pp65/IE−, recipients who were free of pp65/IE antigenemia. TCR BV, T-cell receptor β variable; HCMV, human cytomegalovirus; IE, immediate early.

Discussion

Although HCMV reactivation is commonly observed following immune dysfunction from HSCT, the molecular mechanisms that drive this phenomenon remain unknown. T cell immune responses induced by viral antigens are involved in the inflammatory process of stemming viral infections. CTLs are involved in HCMV control and pathogenesis (16). In PBMCs, >95% of the T cells are αβ+ (17). During T cell development, the TCR β chain undergoes rearrangement earlier than the α chain, according to rules of allelic exclusion. Therefore, analysis of the TCRBV CDR3 gene may be beneficial in determining the clonality of a particular T cell response, and therefore be used as a marker for the functional status of T cells (18). Studies focused on TCR BV gene families may provide novel insights and a solid foundation for the prevention, diagnosis, and treatment of viral infections (19).

The TCR BV gene family demonstrated a diverse, non-skewed expansion in PBMCs derived from the healthy control. However, particular TCR BV families were preferentially expressed or biased, and emerged as a group of monoclonal (oligoclonal) T cells in the PBMCs of all 3 recipients of HSCT. Due to the long-term use of systemic steroids, the T cell response to HCMV is impaired and HCMV reactivation often occurs in patients that have undergone HSCT (20,21). This was determined by the restricted use and oligoclonal expression of TCR BV families following transplantation. The TCR BV gene rearrangement was random without antigen stimulation (22). TCR gene transfer was developed as a promising means of generating large numbers of T cells of a given antigen specificity and functional avidity ex vivo. This technique has demonstrated significant potential for clinical use (23–26).

In the present study, TCR β chain sequences and the presence of HCMV infection were analyzed in recipients of HSCT. A relationship between HCMV reactivation and TCR BV families was observed. TCR BV9 and TCR BV11-positive recipients had HCMV antigenemia. ‘QVRGGTDTQ’ was the most common amino acid sequence observed for TCR BV9 CDR3, and ‘VATDFQ’ was observed for TCR BV11 CDR3. The explanation for this finding may be the multifarious usage of distinctive TCR BV families. Conserved sequences of the TCR BV repertoire were diverse without peptide stimulation, but became more restrictive following stimulation by the HCMV peptide. The clinical course of HCMV reactivation was affected by the usage of TCR BV9 and TCR BV11 in recipients of HSCT. Expression of TCR BV9 and TCR BV11 may be associated with HCMV antigenemia, and may be involved in the immune response. The amino acid sequences ‘QVRGGTDTQ’ and ‘VATDFQ’ may be beneficial for eliciting an anti-viral response, as well as contributing to HCMV clearance. TCR BV with the sequences ‘QVRGGTDTQ’ and ‘VATDFQ’ may, therefore, be a risk factor for HCMV reactivation.

Although the number of patients that underwent HSCT enrolled in the present study was relatively small, each of the patients underwent detailed longitudinal analysis with 10 separate follow-ups over the course of 1 year. In total, >120 samples were analyzed. In addition, the contents of the present study are only a part of longer-term research work. Another challenge regarding the methodology is that the controls would have been improved had they been HCMV-negative patients that underwent HSCT. However, ~100% Han Chinese people are HCMV-IgG positive (27), and HCMV-IgG negative HSCT recipients were not identified. Therefore, such negative controls were not used in the present study.

Given that immune reconstitution must start from the beginning for a patient who has undergone HSCT, these patients are at high risk for HCMV reactivation. The results from the present study provide a link between HCMV reactivation and immune homeostasis, and thus help to establish a prophylaxis and diagnosis of HCMV reactivation following HSCT. Assessment of clonal diversity of TCR against HCMV may provide important insights into the molecular basis of T cell immunodominance. However, further investigation is necessary to address this issue in recipients of HSCT.

Acknowledgements

The present study was supported by the National Natural Science Foundation of China (grant no. 30872239) and the Zhejiang Provincial Natural Science Foundation of China (grant no. LY14H190002).

Glossary

Abbreviations

Abbreviations:

TCR BV

T-cell receptor β variable

CDR3

complementarity determining region 3

HSCT

allogeneic hematopoietic stem cell transplantation

HCMV

human cytomegalovirus

GMSP

gene melting spectral pattern

PBMCs

peripheral blood mononuclear cells

ELISA

enzyme-linked immunosorbent assay

CTLs

cytotoxic T lymphocytes

HBV

hepatitis B virus

HIV

human immunodeficiency virus

References

1 

Gratama JW and Cornelissen JJ: Diagnostic potential of tetramer-based monitoring of cytomegalovirus-specific CD8+ T lymphocytes in allogeneic stem cell transplantation. Clin Immunol. 106:29–35. 2003. View Article : Google Scholar : PubMed/NCBI

2 

Mori T and Kato J: Cytomegalovirus infection/disease after hematopoietic stem cell transplantation. Int J Hematol. 91:588–595. 2010. View Article : Google Scholar : PubMed/NCBI

3 

Moins-Teisserenc H, Busson M, Scieux C, Bajzik V, Cayuela JM, Clave E, de Latour RP, Agbalika F, Ribaud P, Robin M, et al: Patterns of cytomegalovirus reactivation are associated with distinct evolutive profiles of immune reconstitution after allogeneic hematopoietic stem cell transplantation. J Infect Dis. 198:818–826. 2008. View Article : Google Scholar : PubMed/NCBI

4 

Gamadia LE, Rentenaar RJ, Baars PA, Remmerswaal EB, Surachno S, Weel JF, Toebes M, Schumacher TN, ten Berge IJ and van Lier RA: Differentiation of cytomegalovirus-specific CD8(+) T cells in healthy and immunosuppressed virus carriers. Blood. 98:754–761. 2001. View Article : Google Scholar : PubMed/NCBI

5 

Alli R, Zhang ZM, Nguyen P, Zheng JJ and Geiger TL: Rational design of T cell receptors with enhanced sensitivity for antigen. PLoS One. 6:e180272011. View Article : Google Scholar : PubMed/NCBI

6 

Bohne F, Chmielewski M, Ebert G, Wiegmann K, Kürschner T, Schulze A, Urban S, Krönke M, Abken H and Protzer U: T cell redirected against hepatitis B virus surface proteins eliminate infected hepatocytes. Gastroenterology. 134:239–247. 2008. View Article : Google Scholar : PubMed/NCBI

7 

Sommermeyer D, Neudorfer J, Weinhold M, Leisegang M, Engels B, Noessner E, Heemskerk MH, Charo J, Schendel DJ, Blankenstein T, et al: Designer T cells by T cell receptor replacement. Eur J Immunl. 36:3052–3059. 2006. View Article : Google Scholar

8 

Torelli GF, Lucarelli B, Iori AP, De Propris MS, Capobianchi A, Barberi W, Valle V, Iannella E, Natalino F, Mercanti C, et al: The immune reconstitution after an allogeneic stem cell transplant correlates with the risk of graft-versus-host disease and cytomegalovirus infection. Leuk Res. 35:1124–1126. 2011. View Article : Google Scholar : PubMed/NCBI

9 

Abu-Khader A and Krause S: Rapid monitoring of immune reconstitution after allogeneic stem cell transplantation-a comparison of different assays for the detection of cytomegalovirus-specific T cells. Eur J Haematol. 91:534–545. 2013. View Article : Google Scholar : PubMed/NCBI

10 

Yang JZ, Li MW, Wang JG, Lu HF, Yao XS, He JQ and Li LJ: Rapid detection of clonal expansion of T-cell receptor-beta gene in patients with HBV using the real-time PCR with DNA melting curve analysis. Hepatol Res. 40:407–414. 2010. View Article : Google Scholar : PubMed/NCBI

11 

Yang J, He J, Lu H, Wei L, Li S, Wang B, Diao H and Li L: Molecular features of the complementarity determining region 3 motif of the T cell population and subsets in the blood of patients with chronic severe hepatitis B. J Transl Med. 9:2102011. View Article : Google Scholar : PubMed/NCBI

12 

Arenz M, zum Büschenfelde KH Meyer and Löhr HF: Limited T cell receptor Vbeta-chain repertoire of liver-infiltrating T cells in autoimmune hepatitis. J Hepatol. 28:70–77. 1988. View Article : Google Scholar

13 

Yang J, He J, Huang H, Ji Z, Wei L, Ye P, Xu K and Li L: Molecular characterization of T cell receptor beta variable in the peripheral blood T cell repertoire in subjects with active tuberculosis or latent tuberculosis infection. BMC Infect Dis. 13:4232013. View Article : Google Scholar : PubMed/NCBI

14 

Fan J, Zhang X, Chen XM, Gao HN, Yang MF, Zhao H, Hu JH and Ma WH: Monitoring of human cytomegalovirus glycoprotein B genotypes using real-time quantitative PCR in immunocompromised Chinese patients. J Virol Methods. 160:74–77. 2009. View Article : Google Scholar : PubMed/NCBI

15 

Zhang X, Huang YP, Gao HN, Yang MF, Zhao H, Hu JH, Chen XM, Ma WH and Fan J: Quantification of cytomegalovirus glycoprotein Bn DNA in hematopoietic stem cell transplant recipients by real-time PCR. PLoS One. 7:e512242012. View Article : Google Scholar : PubMed/NCBI

16 

Liu A, Ma Y, Wu W, Chen X, Huang Y, Hu J, Liang H, Wang H, Yang R and Fan J: Evaluation of human cytomegalovirus-specific CD8+ T-cells in allogeneic haematopoietic stem cell transplant recipients using pentamer and interferon-γ-enzyme-linked immunospot assays. J Clin Virol. 58:427–431. 2013. View Article : Google Scholar : PubMed/NCBI

17 

Fields BA, Ober B, Malchiodi EL, Lebedeva MI, Braden BC, Ysern X, Kim JK, Shao X, Ward ES and Mariuzza RA: Crystal structure of the V alpha domain of a T cell antigen receptor. Science. 270:1821–1824. 1995. View Article : Google Scholar : PubMed/NCBI

18 

van de Berg PJ, Van Stijn A, Ten Berge IJ and van Lier RA: A fingerprint left by cytomegalovirus infection in the human T cell compartment. J Clin Virol. 41:213–217. 2008. View Article : Google Scholar : PubMed/NCBI

19 

Nakasone H, Tanaka Y, Yamazaki R, Terasako K, Sato M, Sakamoto K, Yamasaki R, Wada H, Ishihara Y, Kawamura K, et al: Single-cell T-cell receptor-β analysis of HLA-A*2402-restricted CMV-pp65-specific cytotoxic T-cells in allogeneic hematopoietic SCT. Bone Marrow Transplant. 49:87–94. 2104. View Article : Google Scholar

20 

Engstrand M, Lidehall AK, Totterman TH, Herrman B, Eriksson BM and Korsgren O: Cellular responses to cytomegalovirus in immunosuppressed patients: Circulating CD8+ T cells recognizing CMVpp65 are present but display functional impairment. Clin Exp Immunol. 132:96–104. 2003. View Article : Google Scholar : PubMed/NCBI

21 

Ozdemir E, St John LS, Gillespie G, Rowland-Jones S, Champlin RE, Molldrem JJ and Komanduri KV: Cytomegalovirus reactivation following allogeneic stem cell transplantation is associated with the presence of dysfunctional antigen-specific CD8+ T cells. Blood. 100:3690–3697. 2002. View Article : Google Scholar : PubMed/NCBI

22 

Matsumoto Y, Matsuo H, Sakuma H, Park IK, Tsukada Y, Kohyama K, Kondo T, Kotorii S and Shibuya N: CDR3 spectratyping analysis of the TCR repertoire in myasthenia gravis. J Immunol. 176:5100–5107. 2006. View Article : Google Scholar : PubMed/NCBI

23 

Frankel TL, Burns WR, Peng PD, Yu Z, Chinnasamy D, Wargo JA, Zheng Z, Restifo NP, Rosenberg SA and Morgan RA: Both CD4 and CD8 T cells mediate equally effective in vivo tumor treatment when engineered with a highly avid TCR targeting tyrosinase. J Immunol. 184:5988–5998. 2010. View Article : Google Scholar : PubMed/NCBI

24 

Ray S, Chhabra A, Chakraborty NG, Hegde U, Dorsky DI, Chodon T, von Euw E, Comin-Anduix B, Koya RC, Ribas A, et al: MHC-Irestricted melanoma antigen specific TCR-engineered human CD4+ T cells exhibit multifunctional effector and helper responses, in vitro. Clin Immunol. 136:338–347. 2010. View Article : Google Scholar : PubMed/NCBI

25 

Kerkar SP, Sanchez-Perez L, Yang S, Borman ZA, Muranski P, Ji Y, Chinnasamy D, Kaiser AD, Hinrichs CS, Klebanoff CA, et al: Genetic engineering of murine CD8+ and CD4+ T cells for preclinical adoptive immunotherapy studies. J Immunother. 34:343–352. 2011. View Article : Google Scholar : PubMed/NCBI

26 

Wang QJ, Hanada K, Feldman SA, Zhao Y, Inozume T and Yang JC: Development of a genetically-modified novel T-cell receptor for adoptive cell transfer against renal cell carcinoma. J Immunol Methods. 366:43–51. 2011. View Article : Google Scholar : PubMed/NCBI

27 

Fan J, Meng XQ, Yang MF, Zhou L, Chen XM, Hu MJ, Fan WW, Ma WH and Li LJ: Association of cytomegalovirus infection with human leukocyte antigen genotypes in recipients after allogeneic liver transplantation. Hepatobiliary Pancreat Dis In. 5:34–38. 2006.

Related Articles

  • Abstract
  • View
  • Download
  • Twitter
Copy and paste a formatted citation
Spandidos Publications style
Wu Z, Zhang H, Jin M, Liang H, Huang Y, Yang R, Gui G, Wang H, Gong S, Wang J, Wang J, et al: Relationship between T-cell receptor beta chain sequences and human cytomegalovirus infection in allogeneic hematopoietic stem cell transplant recipients. Mol Med Rep 15: 3898-3904, 2017.
APA
Wu, Z., Zhang, H., Jin, M., Liang, H., Huang, Y., Yang, R. ... Fan, J. (2017). Relationship between T-cell receptor beta chain sequences and human cytomegalovirus infection in allogeneic hematopoietic stem cell transplant recipients. Molecular Medicine Reports, 15, 3898-3904. https://doi.org/10.3892/mmr.2017.6453
MLA
Wu, Z., Zhang, H., Jin, M., Liang, H., Huang, Y., Yang, R., Gui, G., Wang, H., Gong, S., Wang, J., Fan, J."Relationship between T-cell receptor beta chain sequences and human cytomegalovirus infection in allogeneic hematopoietic stem cell transplant recipients". Molecular Medicine Reports 15.6 (2017): 3898-3904.
Chicago
Wu, Z., Zhang, H., Jin, M., Liang, H., Huang, Y., Yang, R., Gui, G., Wang, H., Gong, S., Wang, J., Fan, J."Relationship between T-cell receptor beta chain sequences and human cytomegalovirus infection in allogeneic hematopoietic stem cell transplant recipients". Molecular Medicine Reports 15, no. 6 (2017): 3898-3904. https://doi.org/10.3892/mmr.2017.6453
Copy and paste a formatted citation
x
Spandidos Publications style
Wu Z, Zhang H, Jin M, Liang H, Huang Y, Yang R, Gui G, Wang H, Gong S, Wang J, Wang J, et al: Relationship between T-cell receptor beta chain sequences and human cytomegalovirus infection in allogeneic hematopoietic stem cell transplant recipients. Mol Med Rep 15: 3898-3904, 2017.
APA
Wu, Z., Zhang, H., Jin, M., Liang, H., Huang, Y., Yang, R. ... Fan, J. (2017). Relationship between T-cell receptor beta chain sequences and human cytomegalovirus infection in allogeneic hematopoietic stem cell transplant recipients. Molecular Medicine Reports, 15, 3898-3904. https://doi.org/10.3892/mmr.2017.6453
MLA
Wu, Z., Zhang, H., Jin, M., Liang, H., Huang, Y., Yang, R., Gui, G., Wang, H., Gong, S., Wang, J., Fan, J."Relationship between T-cell receptor beta chain sequences and human cytomegalovirus infection in allogeneic hematopoietic stem cell transplant recipients". Molecular Medicine Reports 15.6 (2017): 3898-3904.
Chicago
Wu, Z., Zhang, H., Jin, M., Liang, H., Huang, Y., Yang, R., Gui, G., Wang, H., Gong, S., Wang, J., Fan, J."Relationship between T-cell receptor beta chain sequences and human cytomegalovirus infection in allogeneic hematopoietic stem cell transplant recipients". Molecular Medicine Reports 15, no. 6 (2017): 3898-3904. https://doi.org/10.3892/mmr.2017.6453
Follow us
  • Twitter
  • LinkedIn
  • Facebook
About
  • Spandidos Publications
  • Careers
  • Cookie Policy
  • Privacy Policy
How can we help?
  • Help
  • Live Chat
  • Contact
  • Email to our Support Team