Spandidos Publications Logo
  • About
    • About Spandidos
    • Aims and Scopes
    • Abstracting and Indexing
    • Editorial Policies
    • Reprints and Permissions
    • Job Opportunities
    • Terms and Conditions
    • Contact
  • Journals
    • All Journals
    • Oncology Letters
      • Oncology Letters
      • Information for Authors
      • Editorial Policies
      • Editorial Board
      • Aims and Scope
      • Abstracting and Indexing
      • Bibliographic Information
      • Archive
    • International Journal of Oncology
      • International Journal of Oncology
      • Information for Authors
      • Editorial Policies
      • Editorial Board
      • Aims and Scope
      • Abstracting and Indexing
      • Bibliographic Information
      • Archive
    • Molecular and Clinical Oncology
      • Molecular and Clinical Oncology
      • Information for Authors
      • Editorial Policies
      • Editorial Board
      • Aims and Scope
      • Abstracting and Indexing
      • Bibliographic Information
      • Archive
    • Experimental and Therapeutic Medicine
      • Experimental and Therapeutic Medicine
      • Information for Authors
      • Editorial Policies
      • Editorial Board
      • Aims and Scope
      • Abstracting and Indexing
      • Bibliographic Information
      • Archive
    • International Journal of Molecular Medicine
      • International Journal of Molecular Medicine
      • Information for Authors
      • Editorial Policies
      • Editorial Board
      • Aims and Scope
      • Abstracting and Indexing
      • Bibliographic Information
      • Archive
    • Biomedical Reports
      • Biomedical Reports
      • Information for Authors
      • Editorial Policies
      • Editorial Board
      • Aims and Scope
      • Abstracting and Indexing
      • Bibliographic Information
      • Archive
    • Oncology Reports
      • Oncology Reports
      • Information for Authors
      • Editorial Policies
      • Editorial Board
      • Aims and Scope
      • Abstracting and Indexing
      • Bibliographic Information
      • Archive
    • Molecular Medicine Reports
      • Molecular Medicine Reports
      • Information for Authors
      • Editorial Policies
      • Editorial Board
      • Aims and Scope
      • Abstracting and Indexing
      • Bibliographic Information
      • Archive
    • World Academy of Sciences Journal
      • World Academy of Sciences Journal
      • Information for Authors
      • Editorial Policies
      • Editorial Board
      • Aims and Scope
      • Abstracting and Indexing
      • Bibliographic Information
      • Archive
    • International Journal of Functional Nutrition
      • International Journal of Functional Nutrition
      • Information for Authors
      • Editorial Policies
      • Editorial Board
      • Aims and Scope
      • Abstracting and Indexing
      • Bibliographic Information
      • Archive
    • International Journal of Epigenetics
      • International Journal of Epigenetics
      • Information for Authors
      • Editorial Policies
      • Editorial Board
      • Aims and Scope
      • Abstracting and Indexing
      • Bibliographic Information
      • Archive
    • Medicine International
      • Medicine International
      • Information for Authors
      • Editorial Policies
      • Editorial Board
      • Aims and Scope
      • Abstracting and Indexing
      • Bibliographic Information
      • Archive
  • Articles
  • Information
    • Information for Authors
    • Information for Reviewers
    • Information for Librarians
    • Information for Advertisers
    • Conferences
  • Language Editing
Spandidos Publications Logo
  • About
    • About Spandidos
    • Aims and Scopes
    • Abstracting and Indexing
    • Editorial Policies
    • Reprints and Permissions
    • Job Opportunities
    • Terms and Conditions
    • Contact
  • Journals
    • All Journals
    • Biomedical Reports
      • Information for Authors
      • Editorial Policies
      • Editorial Board
      • Aims and Scope
      • Abstracting and Indexing
      • Bibliographic Information
      • Archive
    • Experimental and Therapeutic Medicine
      • Information for Authors
      • Editorial Policies
      • Editorial Board
      • Aims and Scope
      • Abstracting and Indexing
      • Bibliographic Information
      • Archive
    • International Journal of Epigenetics
      • Information for Authors
      • Editorial Policies
      • Editorial Board
      • Aims and Scope
      • Abstracting and Indexing
      • Bibliographic Information
      • Archive
    • International Journal of Functional Nutrition
      • Information for Authors
      • Editorial Policies
      • Editorial Board
      • Aims and Scope
      • Abstracting and Indexing
      • Bibliographic Information
      • Archive
    • International Journal of Molecular Medicine
      • Information for Authors
      • Editorial Policies
      • Editorial Board
      • Aims and Scope
      • Abstracting and Indexing
      • Bibliographic Information
      • Archive
    • International Journal of Oncology
      • Information for Authors
      • Editorial Policies
      • Editorial Board
      • Aims and Scope
      • Abstracting and Indexing
      • Bibliographic Information
      • Archive
    • Medicine International
      • Information for Authors
      • Editorial Policies
      • Editorial Board
      • Aims and Scope
      • Abstracting and Indexing
      • Bibliographic Information
      • Archive
    • Molecular and Clinical Oncology
      • Information for Authors
      • Editorial Policies
      • Editorial Board
      • Aims and Scope
      • Abstracting and Indexing
      • Bibliographic Information
      • Archive
    • Molecular Medicine Reports
      • Information for Authors
      • Editorial Policies
      • Editorial Board
      • Aims and Scope
      • Abstracting and Indexing
      • Bibliographic Information
      • Archive
    • Oncology Letters
      • Information for Authors
      • Editorial Policies
      • Editorial Board
      • Aims and Scope
      • Abstracting and Indexing
      • Bibliographic Information
      • Archive
    • Oncology Reports
      • Information for Authors
      • Editorial Policies
      • Editorial Board
      • Aims and Scope
      • Abstracting and Indexing
      • Bibliographic Information
      • Archive
    • World Academy of Sciences Journal
      • Information for Authors
      • Editorial Policies
      • Editorial Board
      • Aims and Scope
      • Abstracting and Indexing
      • Bibliographic Information
      • Archive
  • Articles
  • Information
    • For Authors
    • For Reviewers
    • For Librarians
    • For Advertisers
    • Conferences
  • Language Editing
Login Register Submit
  • This site uses cookies
  • You can change your cookie settings at any time by following the instructions in our Cookie Policy. To find out more, you may read our Privacy Policy.

    I agree
Search articles by DOI, keyword, author or affiliation
Search
Advanced Search
presentation
International Journal of Molecular Medicine
Join Editorial Board Propose a Special Issue
Print ISSN: 1107-3756 Online ISSN: 1791-244X
Journal Cover
2014-January Volume 33 Issue 1

Full Size Image

Sign up for eToc alerts
Recommend to Library

Journals

International Journal of Molecular Medicine

International Journal of Molecular Medicine

International Journal of Molecular Medicine is an international journal devoted to molecular mechanisms of human disease.

International Journal of Oncology

International Journal of Oncology

International Journal of Oncology is an international journal devoted to oncology research and cancer treatment.

Molecular Medicine Reports

Molecular Medicine Reports

Covers molecular medicine topics such as pharmacology, pathology, genetics, neuroscience, infectious diseases, molecular cardiology, and molecular surgery.

Oncology Reports

Oncology Reports

Oncology Reports is an international journal devoted to fundamental and applied research in Oncology.

Experimental and Therapeutic Medicine

Experimental and Therapeutic Medicine

Experimental and Therapeutic Medicine is an international journal devoted to laboratory and clinical medicine.

Oncology Letters

Oncology Letters

Oncology Letters is an international journal devoted to Experimental and Clinical Oncology.

Biomedical Reports

Biomedical Reports

Explores a wide range of biological and medical fields, including pharmacology, genetics, microbiology, neuroscience, and molecular cardiology.

Molecular and Clinical Oncology

Molecular and Clinical Oncology

International journal addressing all aspects of oncology research, from tumorigenesis and oncogenes to chemotherapy and metastasis.

World Academy of Sciences Journal

World Academy of Sciences Journal

Multidisciplinary open-access journal spanning biochemistry, genetics, neuroscience, environmental health, and synthetic biology.

International Journal of Functional Nutrition

International Journal of Functional Nutrition

Open-access journal combining biochemistry, pharmacology, immunology, and genetics to advance health through functional nutrition.

International Journal of Epigenetics

International Journal of Epigenetics

Publishes open-access research on using epigenetics to advance understanding and treatment of human disease.

Medicine International

Medicine International

An International Open Access Journal Devoted to General Medicine.

Journal Cover
2014-January Volume 33 Issue 1

Full Size Image

Sign up for eToc alerts
Recommend to Library

  • Article
  • Citations
    • Cite This Article
    • Download Citation
    • Create Citation Alert
    • Remove Citation Alert
    • Cited By
  • Similar Articles
    • Related Articles (in Spandidos Publications)
    • Similar Articles (Google Scholar)
    • Similar Articles (PubMed)
  • Download PDF
  • Download XML
  • View XML
Article

A novel ribonuclease with antiproliferative activity toward leukemia and lymphoma cells and HIV-1 reverse transcriptase inhibitory activity from the mushroom, Hohenbuehelia serotina

  • Authors:
    • Rui  Zhang
    • Liyan  Zhao
    • Hexiang  Wang
    • Tzi  Bun Ng
  • View Affiliations / Copyright

    Affiliations: State Key Laboratory for Agrobiotechnology and Department of Microbiology, China Agricultural University, Beijing 100193, P.R. China, College of Food Science and Technology, Nanjing Agricultural University, Weigang, Nanjing 210095, P.R. China, School of Biomedical Sciences, Faculty of Medicine, The Chinese University of Hong Kong, Shatin, New Territories, Hong Kong, SAR, P.R. China
  • Pages: 209-214
    |
    Published online on: November 12, 2013
       https://doi.org/10.3892/ijmm.2013.1553
  • Expand metrics +
Metrics: Total Views: 0 (Spandidos Publications: | PMC Statistics: )
Metrics: Total PDF Downloads: 0 (Spandidos Publications: | PMC Statistics: )
Cited By (CrossRef): 0 citations Loading Articles...

This article is mentioned in:


Abstract

In this study, a 27-kDa ribonuclease (RNase) was purified from the dried fruiting bodies of the mushroom, Hohenbuehelia serotina. The isolation protocol involved anion exchange chromatography, affinity chromatography, cation exchange chromatography and gel filtration in succession. The RNase was unadsorbed on DEAE-cellulose, but was adsorbed on Affi-gel blue gel and CM-cellulose. The N-terminal amino acid sequence was TVGGSLAEKGN which showed homology to other fungal RNases to a certain degree. The RNase exhibited maximal RNase activity at pH 5 and 80˚C. It demonstrated the highest ribonucleolytic activity toward poly(C), a relatively high activity toward poly(U), and a considerably weaker activity toward poly(A) and (G). The RNase inhibited human immunodeficiency virus type 1 (HIV-1) reverse transcriptase with an IC50 of 50 µM and reduced [3H-methyl]-thymidine uptake by L1210 leukemia cells and MBL2 lymphoma cells with an IC50 of 25 µM and 40 µM, respectively.

Introduction

The literature pertaining to the Hohenbuehelia species is limited and confined to the following reports. Vafina and Molodtsov described the synthesis of some p-nitrophenyl 2-acylamino-2-deoxy-D-glucosides and their hydrolysis using Hohenbuehelia serotina β-D-hexosaminidase (1). The culture filtrate of Hohenbuehelia geogenius inhibited the growth of two rapidly growing grafted tumors (Ehrlich ascites carcinoma and L1210 lymphoid leukemia) and a slow-growing spontaneous mammary tumor in mice. An active substance was isolated by solid-liquid extraction and column chromatography and its chemical structure was elucidated (2).

Anti-A agglutinins, the reaction of which has been shown to be strongly inhibited by N-acetyl-D-galactosamine, have been detected in Hohenbuehelia serotina extracts (3). Two strains of Hohenbuehelia atrocaerulea (Pleurotaceae) that produce pleurotin, a naphthoquinone antibiotic originally obtained from Pleurotus griseus, have been identified. Solid substrate fermentation for two months yielded 1–2 mg/l of pleurotin. Shipley et al (4) detailed the developmental process, which depended on inclusion in the medium of an aqueous extract of alder woodm leading to a yield of pleurotin exceeding 300 mg/l from liquid fermentation. Bala et al reported that water, ethanol and hexane extracts of the Hohenbuehelia species inhibited growth of Gram-positive Staphylococcus aureus and Gram-negative Escherichia coli (5). Bala et al (6) further demonstrated that a water extract of Hohenbuehelia species inhibited six pathogens each comprising of two Gram-positive and -negative bacteria together with two fungi.

Polysaccharides extracted from the fruiting bodies of Hohenbuehelia serotina have exhibited antitumor activity in sarcoma 180-bearing mice (7). The molecular weights of these polysaccharides ranged from 1.19×103 to 1.55×104 Da and composed of ribose, arabinose, mannose, glucose and galactose at a ratio of 0.65:0.69:9.35:14.24:5.47; they were isolated by Li et al (8). However, there is a dearth of information on the proteinaceous constituents of the Hohenbuehelia species.

Ribonucleases (RNases) have been isolated and characterized from a multitude of organisms, including parasites, bacteria, fungi, plants and a variety of tissues from mammals (9–17) RNases display different activities, such as antitumor (18–25), immunosuppressive (26), antifungal (27), and antiviral (28,29) activities. Due to the array of potentially exploitable activities, RNases have drawn the attention of many researchers.

RNases have been purified from the fruiting bodies or mycelia of a diversity of mushroom species. These mushrooms include some common edible and medicinal species as follows: Pleurotus ostreatus (30,31), Irpex lacteus (32), Volvariella volvacea (33), Pleurotus tuber-regium (34), Pleurotus pulmonarius (35), Agrocybe cylindracea (36), Russula virescens (37), Termitomyces globules (38), Cantharellus cibarius (39), Pleurotus sajor-caju (40), Ganoderma lucidum (41), Clitocybe maxima (42), Thelephora ganbajun (43), Boletus griseus (44), Hypsizigus marmoreus (45), Russula delica (16,46) and Lyophyllum shimeiji (47). The aim of this study was to isolate and characterize an RNase isolated from the dried fruiting bodies of the edible fungus, Hohenbuehelia serotina, and to compare its characteristics and N-terminal sequence with those of RNases isolated from the aforementioned species. The comparison would reveal any differences between RNases from different species and our findings may expand the knowledge and provide further information on this fungus.

Materials and methods

Isolation of RNase from Hohenbuehelia serotina

The dried fruiting bodies (200 g) of the edible mushroom, Hohenbuehelia serotina, obtained from North China were extracted with distilled water (2 ml/g) using a Waring blender (Waring Laboratory Supplies, Torrington, CT, USA). Tris-HCl buffer (pH 7.2, 1 M) was added to the supernatant, obtained by centrifugation of the homogenate, until the concentration of Tris reached 10 mM. The supernatant was subjected to ion exchange chromatography on a 5×15 cm column of DEAE-cellulose (Sigma, St. Louis, MO, USA) in 10 mM Tris-HCl buffer (pH 7.2). Following elution of the unadsorbed proteins (fraction D1) with the same buffer, the adsorbed proteins were desorbed sequentially with 0.2 M NaCl and 1 M NaCl in Tris-HCl buffer to form fractions D2 and D3, respectively. Fraction D1 was then directly chromatographed on a 5×15 cm Affi-gel blue gel column (Bio-Rad, Hercules, CA, USA) in 10 mM Tris-HCl buffer (pH 7.2). The unadsorbed proteins were eluted as fraction B1. The adsorbed proteins were eluted sequentially with 0.2 M NaCl and 1 M NaCl in Tris-HCl buffer and collected as fractions B2 and B3, respectively. Fraction B2 was dialyzed against 10 mM NH4OAc buffer (pH 5) subjected to ion exchange chromatography on a 2.5×20 cm CM-cellulose (Sigma) column in 10 mM NH4OAc buffer (pH 5). Following the removal of the unadsorbed proteins (fraction CM1), the adsorbed proteins were eluted with 10 mM NH4OAc buffer (pH 5) containing a linear gradient of 0–1 M NaCl, and collected as fractions CM2 and CM3. Fraction CM3 was dialyzed, lyophilized and further purified on a Superdex 75 HR 10/30 column in 0.2 M NH4HCO3 buffer (pH 8.5) using an AKTA Purifier (GE Healthcare, Piscataway, NJ, USA).

Molecular mass determination by sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE) and by fast protein liquid chromatography (FPLC)-gel filtration

SDS-PAGE was conducted following the protocol of Laemmli and Favre (48), using a 12% resolving gel and a 5% stacking gel. At the conclusion of electrophoresis, staining of the gel with Coomassie brilliant blue was carried out. FPLC-gel filtration was performed using a Superdex 75 HR 10/30 column that had been calibrated with molecular mass standards using an AKTA Purifier (GE Healthcare).

Analysis of N-terminal amino acid sequence

The amino-acid sequence of the purified protein was determined by means of automated Edman degradation. The amino acid sequence was determined using an HP G1000A Edman degradation unit and an HP 1000 HPLC system (Agilent Technologies, Santa Clara, CA, USA).

Assay for RNase activity

The activity of the purified RNase toward yeast tRNA (Sigma) was assayed by determining the generation of acid-soluble UV-absorbing species (reaction products) with the method of Wang and Ng (52). The RNase was incubated with 200 μg tRNA in 150 μg of 100 mM MES buffer (pH 6.0) at 37°C for 1 h. The reaction was terminated by the addition of 350 μl of ice-cold 3.4% perchloric acid. After remaining on ice for 15 min, the sample was centrifuged (15,000 × g) at 4°C for 15 min. The OD260 of the supernatant was read after appropriate dilution. One unit of enzymatic activity is defined as the amount of enzyme that induces an increase in OD260 of one per minute in the acid-soluble fraction per milliliter of reaction mixture under the specified conditions.

Activity of RNase toward polyhomoribonucleotides

The ribonucleolytic activity of the purified RNase toward various polyhomoribonucleotides as substrates was determined with a modification of a previously described method (33). The incubation of RNase with 100 μg poly(A), poly(C), poly(G) or poly(U) was carried out at 37°C for 1 h in 250 μl of 100 mM sodium acetate buffer (pH 5.0), prior to the addition of 250 μl of ice-cold 1.2 N perchloric acid containing 20 mM lanthanum nitrate to terminate the reaction. The reaction mixture was left on ice for 15 min prior to centrifugation at 15,000 × g for 15 min at 4°C. After appropriate dilution, the absorbance of the supernatant was read at 260 nm [for substrates poly(A), poly(G) and poly(U)] or at 280 nm [for substrate poly(C)].

Assay for ability to inhibit human immunodeficiency virus type 1 reverse transcriptase (HIV-1 RT)

The assay to determine the HIV-1 RT inhibitory activity of Hohenbuehelia serotina RNase was executed using a non-radioactive reverse transcriptase ELISA kit (Sigma-Aldrich, Trading Co., Ltd., Shanghai, China) as previously described (49).

Assay for anti-proliferative activity of RNase isolated from Hohenbuehelia serotina

The anti-proliferative activity of the purified RNase was determined as follows: the L1210 and MBL2 cells were maintained in Dulbecco’s modified Eagle’s medium (DMEM) supplemented with 10% fetal bovine serum (FBS) and 100 mg/l streptomycin and 100 IU/ml penicillin, at 37°C in a humidified atmosphere of 5% CO2. Cells (1×104) in their exponential growth phase were seeded into each well of a 96-well culture plate and incubated for 3 h prior to the addition of the purified RNase followed by incubation for a further 48 h. The radioactive precursor, 1 μCi [3H-methyl]-thymidine, was added to each well followed by incubation for 6 h before the cultures were harvested by means of a cell harvester. The incorporated radioactivity was determined by liquid scintillation counting, as previously described (40).

Results

Isolation of RNase

Ion exchange chromatography of the extract on DEAE-cellulose yielded three fractions D1, D2 and D3 containing similar amounts of proteins. RNase activity was found only in the unadsorbed fraction D1. D1 was separated on Affi-gel blue gel into one unadsorbed and also the largest fraction (B1), together with two adsorbed fractions (B2 and B3). Fraction B2 was the only fraction with strong RNase activity. This fraction was resolved on CM-cellulose into an unadsorbed fraction CM1 devoid of RNase activity, an adsorbed fraction CM2 with weak RNase activity, and the most strongly adsorbed fraction CM3 containing the bulk of RNase activity (Fig. 1). Fraction CM3 was resolved into three fractions, SU1, SU2 and SU3 upon gel filtration on Superdex 75. RNase activity resided in the second fraction SU2 (Fig. 2 and Table I).

Figure 1

Ion exchange chromatography on CM-Sepharose. Sample: fraction B2 which was previously adsorbed on Affi-gel blue gel. Column dimensions: 2.5×20 cm. Starting buffer: 10 mM NH4Ac (pH 5.2). Slanting dotted line across the right side of the chromatogram represents the linear 0–1 M NaCl gradient used to elute adsorbed proteins.

Figure 2

FPLC-gel filtration of fraction CM3 on a Superdex 75 HR10/30 column. Buffer, 0.2 M NH4HCO3 (pH 8.5); flow rate, 0.4 ml/min; fraction size, 0.8 ml.

Table I

Yields (from 650 g fresh Hohenbuehelia serotina fruiting bodies) and RNase activity (determined in 0.1 M MES buffer, pH 6.0, 37°C) of various chromatographic fractions.

Table I

Yields (from 650 g fresh Hohenbuehelia serotina fruiting bodies) and RNase activity (determined in 0.1 M MES buffer, pH 6.0, 37°C) of various chromatographic fractions.

FractionYield (mg)RNase activity (U/mg)FractionYield (mg)RNase activity (U/mg)
Extract201835.7CM119.0<1
D145998.6CM213.451.8
D240312.5CM323.5983.0
D3529<1SU13.6102.8
B1165<1SU26.92705.3
B279.3369.5SU35.986.1
B381.215.7

[i] RNase, ribonuclease.

Determination of molecular mass

Fraction SU2 appeared as a single band with a molecular mass of 27 kDa, as shown by SDS-PAGE (Fig. 3).

Figure 3

Sodium dodecyl sulfate polyacrylamide gel electrophoresis (SDS-PAGE) of purified Hohenbuehelia serotina ribonuclease (RNase) (fraction SU2). The molecular mass of the marker proteins are, from top to bottom, 94, 67, 43, 30, 20 and 14.4 kDa.

Analysis of N-terminal amino acid sequence

The amino acid sequence was abtained by an HP 1000 HPLC system depending on Edman degradation. The N-terminal sequence was as follows: TVGGSLAEKGN, which showed homology to other fungal RNases to a certain degree (Table II).

Table II

N-terminal sequence of Hohenbuehelia serotina (HS) ribonuclease (RNase) in comparison with RNases isolated from other mushrooms.

Table II

N-terminal sequence of Hohenbuehelia serotina (HS) ribonuclease (RNase) in comparison with RNases isolated from other mushrooms.

RNaseN-terminal sequence
HS:TVGGSLAEKGN
TG: DADIAVWAPPVNAQN
CM: ETAHTHAGIQYSTVDVNNSIMKAVGGGAGN
PP: AISANNERKGVNQQSVQNTYQENDV
VV: APYVQLFRPLIQPQVLATFAIANNMAQY
LE: ISSGCGTTGALSCSSNAKGTCCFEAPGGLI
IL: VNSGCGTSGAESCSNSDDGTCCFEAPGGLL
DI:GQPRQPQPQLLV
PE:GEVVQYYP
PS:DNGEAGRAAR
GL: HLPBVPSFAYGSIKVYIN
RV: TDHTLDTMMTHTLRD
PO: ETGVRSCNCAGRSFTGTDVTNAIRSARAGGSGN
PT: ALTAQDNRVRVGNRIVGNNFNFAAVQAAYY

[i] TG, Thelephora ganbajun; CM, Clitocybe maxima; PP, Pleurotus pulmonarius; VV, Volvariella volvacea; LE, Lentinus edodes; IL, Irpex lacteus; DI, Dictyophora indusiata; PE, Pleurotus eryngii; PS, Pleurotus sajor-caju; GL, Ganoderma lucidum; RV, Russulus virescens; PO, Pleurotus ostreatus; PT, Pleurotus tuber-regium.

Determination of optimum pH and optimum temperature

The optimum pH (Fig. 4) and temperature (Fig. 5) for the purified RNase were pH 5.0 and 80°C, respectively.

Figure 4

pH dependence of Hohenbuehelia serotina ribonuclease (RNase). Temperature used: 37°C. Duration of incubation: 15 min. Buffer concentration: 0.1 M.

Figure 5

Temperature dependence of Hohenbuehelia serotina ribonuclease (RNase). Buffer used: 0.1 M NH4Ac buffer (pH 4.5). Duration of incubation, 15 min.

Determination of polyhomoribonucleotide specificity

The RNase exerted a ribonucleolytic activity of 455.1, 311.2, 119.4 and 105 U/mg toward poly(C), poly(U), poly(A) and poly(G), respectively.

HIV-1 RT inhibitory activity

The RNase inhibited HIV-1 RT with an IC50 of 50 μM (Table III).

Table III

Inhibition rates (%) of RNase on growth of MBL2 cells, L1210 cells, and HIV-1 RT.

Table III

Inhibition rates (%) of RNase on growth of MBL2 cells, L1210 cells, and HIV-1 RT.

Inhibition rates (%)

Dose (μM)HIV-1 RTL1210MBL2
1013.5±0.924.6±1.818.7±1.1
2021.4±1.640.9±2.731.4±2.3
4042.1±2.772.1±5.249.7±3.8
8073.4±4.394.3±5.573.6±5.9
IC50 (μM)49.924.840.3

[i] RNase, ribonuclease; HIV-1 RT, human immunodeficiency virus type 1 reverse transcriptase.

Anti-proliferative activity toward tumor cells

The RNase inhibited [3H-methyl]-thymidine uptake by L1210 cells and MBL2 cells with an IC50 of 25 and 40 μM, respectively (Table III).

Discussion

RNase isolated from Hohenbuehelia serotina is characterized by an N-terminal sequence distinctly different from that of previously reported mushroom and non-mushroom RNases. The molecular weight of previously reported mushroom RNases ranges from 9 to 42.5 kDa. The molecular mass of Hohenbuehelia serotina RNase (27 kDa) lies within this range. It is larger than the mass of RNases isolated from Clitocybe maxima (42), Hypsizigus marmoreus (45), Lyophyllum shimeiji (47), Pleurotus djamor (50), Pleurotus eryngii (51), Pleurotus ostreatus (31), Pleurotus pulmonarius (35), Pleurotus sajor-caju (40), Russula delica (46) and Thelephora ganbajun (43), but smaller than the mass of RNases isolated from Boletus griseus (44), Dictyophora indusiata (52), Ganoderma lucidum (43), Pleurotus tuber-regium (34), Russulus virescens (37) and Volvariella volvacea (33). Its mass is close to that of Dictyophora indusiata RNase (28 kDa) and Russulus virescens RNase (28 kDa). All these RNases are monomeric, and all of them are acid RNases.

RNases isolated from different mushrooms may have different optimum pH values and temperatures for RNase activity. The optimum pH of Hohenbuehelia serotina RNase (pH 5.0) is similar to that of Hypsizigus marmoreus RNase (pH 5.0) [Guan et al (45)] and Russula delica RNase (pH 5.0) [Zhao et al (46)]; however, Hohenbuehelia serotina RNase is much more thermostable. The optimum temperature for the purified Hohenbuehelia serotina RNase was found to be 80°C, which is the highest optimum temperature for RNases purified from mushrooms.

Some RNases display antiviral activity. Zinc-finger antiviral protein inhibits HIV-1 infection by selectively targeting multiply spliced viral mRNAs for degradation [Zhu et al (53)]. Rana catesbeiana RNase inhibits Japanese encephalitis virus (JEV) replication and enhances apoptosis of JEV-infected BHK-21 cells.

Li et al (54) suggested that the targeted RNase is an alternative anti-hepatitis B virus (HBV) agent. The HIV-1 RT inhibitory activity of Hohenbuehelia serotina RNase has been shown to be similar to that of RNases isolated from other mushrooms, such as Lyophyllum shimeiji (47) and Thelephora ganbajun (43). The mechanisms responsible for the inhibitory effects on HIV-1 RT may involve protein-protein interaction, as in the case of the inhibition of HIV-1 RT by the homologous protease (55) and the inhibition of HIV-1 protease by cathelicidin [Wong et al (56)].

Some RNases exert inhibitory effects on tumor cells. The binding of AS RNase and CM-AS RNase to leukaemic cells from patients with chronic lymphatic leukaemia has been demonstrated by indirect immunofluorescence, while no binding to normal leucocytes and leucocytes from patients with other hemoblastoses was observed (24). Bovine seminal RNase (BS-RNase) manifests specific cytotoxic effects on tumor cells, and non-malignant cells are not affected. In view of the finding that success was met only when BS-RNase was applied intratumorally, the properties of BS-RNase were improved by attachment to polylactic acid nanoparticles. The nanoparticle preparation and pure BS-RNase showed no difference when tested against leukemia (MOLT-4) and lymphoma (H9) cell lines sensitive and resistant to cytarabine in vitro. The aspermatogenic and anti-embryonal activities were augmented in the nanoparticle preparation of BS-RNase. It remains to be seen how well BS-RNase attached to polylactic acid nanoparticles performs as an antitumoral agent in vivo [Michaelis et al (57)]. The anticancer effect of the amphibian RNase Onconase as demonstrated experimentally and in clinical trials has been reported (58). Plant RNases have also been shown to exhibit antitumor effects in a number of studies (18,20,22).

Mushroom RNases have been shown to be effective against hepatoma and breast cancer cells (46). Zhao et al (16) noted that Schizophyllum commune RNase had no effect on the proliferation of leukemia and lymphoma cells. Only a few mushroom RNases have been shown to inhibit the growth of leukemia cells (36,40,59,60). We found that the anti-proliferative activities of Hohenbuehelia serotina RNase toward L1210 cells are not as remarkable as those of Pleurotus sajor-caju RNase (40), but more effective than those of Hypsizigus marmoreus RNase (45). To our knowledge, we also demonstrated for the first time that mushroom RNases exhibit anti-proliferative activity toward MBL2 cells.

Some plant RNases have antifungal activity (27,34,61) and have been classified as one family of pathogenesis-related proteins. It is interesting to note that Hohenbuehelia serotina RNase, similar to all previously reported mushroom RNases, is devoid of antifungal activity. However, its antiproliferative activity against cancer cells and its inhibitory activity toward HIV-I RT signify that it is a defense protein. Its RNase activity can be deployed against invaders.

In conlcusion, the RNase isolated from Hohenbuehelia serotina in the present study is a novel RNase, as evidenced by a novel N-terminal sequence and a high optimum pH. It manifests potent anti-proliferative activity toward cancer cells and inhibitory activity toward HIV-1 RT. These biological activities are potentially exploitable. In this regard it is noteworthy that not all previously reported mushroom RNases were assayed for or demonstrate anti-proliferative and HIV-1 RT inhibitory activities.

Acknowledgements

This study was financially supported by the National Grants of China (no. 2010CB732202) and the Special Fund for Agro-scientific Research in the Public Interest (no. 201303080).

References

1 

Vafina MG and Molodtsov NV: Synthesis of some p-nitrophenyl 2-acylamino-2-deoxy-D-glucosides and their hydrolysis with the beta-D-hexosaminidase from Hohenbuehelia serotina. Carbohyd Res. 47:188–194. 1976. View Article : Google Scholar : PubMed/NCBI

2 

Riondel J, Beriel H, Dardas A, Carraz G and Oddoux L: Studies of antitumor activity of the culture filtrate of Hohenbuehelia geogenius (D.C. ex Fr.) Sing (basidiomycete). Arzneimittelforschung. 31:293–299. 1981.PubMed/NCBI

3 

Furukawa K, Ying R, Nakajima T and Matsuki T: Hemagglutinins in fungus extracts and their blood group specificity. Exp Clin Immunogenet. 12:223–231. 1995.PubMed/NCBI

4 

Shipley SM, Barr AL, Graf SJ, Collins RP, McCloud TG and Newman DJ: Development of a process for the production of the anticancer lead compound pleurotin by fermentation of Hohenbuehelia atrocaerulea. J Ind Microbiol Biotechnol. 33:463–468. 2006. View Article : Google Scholar : PubMed/NCBI

5 

Bala N, Aitken EA, Fechner N, Cusack A and Steadman KJ: Evaluation of antibacterial activity of Australian basidiomycetous macrofungi using a high-throughput 96-well plate assay. Pharm Biol. 49:492–500. 2011. View Article : Google Scholar : PubMed/NCBI

6 

Bala N, Aitken EA, Cusack A and Steadman KJ: Antimicrobial potential of Australian macrofungi extracts against foodborne and other pathogens. Phytother Res. 26:465–469. 2012.PubMed/NCBI

7 

Ma Y, Mizuno T and Ito H: Antitumor activity of some polysaccharides isolated from a Chinese mushroom, ‘huangmo’, the fruiting body of Hohenbuehelia serotina. Agric Biol Chem. 55:2701–2710. 1991.

8 

Li X, Wang Z, Wang L, Walid E and Zhang H: Ultrasonic-assisted extraction of polysaccharides from Hohenbuehelia serotina by response surface methodology. Int J Biol Macromol. 51:523–530. 2012. View Article : Google Scholar

9 

Kikovska E, Wu S, Mao G and Kirsebom LA: Cleavage mediated by the P15 domain of bacterial RNase P RNA. Nucleic Acids Res. 40:2224–2233. 2012. View Article : Google Scholar : PubMed/NCBI

10 

Daoud R, Forget L and Lang BF: Yeast mitochondrial RNase P, RNase Z and the RNA degradosome are part of a stable supercomplex. Nucleic Acids Res. 40:1728–1736. 2012. View Article : Google Scholar : PubMed/NCBI

11 

Gardner AF, Prangishvili D and Jack WE: Characterization of Sulfolobus islandicus rod-shaped virus 2 gp19, a single-strand specific endonuclease. Extremophiles. 15:619–624. 2011.

12 

Hillwig MS, Kanobe C, Thornburg RW and Macintosh GC: Identification of S-RNase and peroxidase in petunia nectar. J Plant Physiol. 168:734–738. 2011. View Article : Google Scholar : PubMed/NCBI

13 

Lai LB, Chan PP, Cozen AE, Bernick DL, Brown JW, Gopalan V and Lowe TM: Discovery of a minimal form of RNase P in Pyrobaculum. Proc Natl Acad Sci USA. 107:22493–22498. 2010. View Article : Google Scholar : PubMed/NCBI

14 

Lee OR, Pulla RK, Kim YJ, Balusamy SR and Yang DC: Expression and stress tolerance of PR10 genes from Panax ginseng C. A. Meyer. Mol Biol Rep. 39:2365–2374. 2012. View Article : Google Scholar : PubMed/NCBI

15 

Schroeder J: Purification of antimicrobial peptides from human skin. Methods Mol Biol. 618:15–30. 2010. View Article : Google Scholar : PubMed/NCBI

16 

Zhao YC, Zhang GQ, Ng TB and Wang HX: A novel ribonuclease with potent HIV-1 reverse transcriptase inhibitory activity from cultured mushroom Schizophyllum commune. J Microbiol. 49:803–808. 2011. View Article : Google Scholar : PubMed/NCBI

17 

Teng PK, Anderson NJ, Goldschmidt L, Sawaya MR, Sambashivan S and Eisenberg D: Ribonuclease A suggests how proteins self-chaperone against amyloid fiber formation. Protein Sci. 21:262012. View Article : Google Scholar : PubMed/NCBI

18 

Fang Fei Fang EF, Zhang CZ, Zhang L, Fong WP and Ng TB: In vitro and in vivo anticarcinogenic effects of RNase MC2, a ribonuclease isolated from dietary bitter gourd, toward human liver cancer cells. Int J Biochem Cell Biol. 44:1351–1360. 2012.PubMed/NCBI

19 

D’Errico G, Ercole C, Lista M, Pizzo E, Falanga A, Galdiero S, Spadaccini R and Picone D: Enforcing the positive charge of N-termini enhances membrane interaction and antitumor activity of bovine seminal ribonuclease. Biochim Biophys Acta. 1808:3007–3015. 2011.PubMed/NCBI

20 

Fang EF, Zhang CZ, Fong WP and Ng TB: RNase MC2: a new Momordica charantia ribonuclease that induces apoptosis in breast cancer cells associated with activation of MAPKs and induction of caspase pathways. Apoptosis. 17:377–387. 2012. View Article : Google Scholar : PubMed/NCBI

21 

Fang EF and Ng TB: Ribonucleases of different origins with a wide spectrum of medicinal applications. Biochim Biophys Acta. 1815:65–74. 2011.PubMed/NCBI

22 

Matousek J and Matousek J: Plant ribonucleases and nucleases as antiproliferative agens targeting human tumors growing in mice. Recent Pat DNA Gene Seq. 4:29–39. 2010. View Article : Google Scholar : PubMed/NCBI

23 

Michaelis M, Matousek J, Vogel JU, Slavik T, Langer K and Cinatl J, Kreuter J, Schwabe D and Cinatl J: Bovine seminal ribonuclease attached to nanoparticles made of polylactic acid kills leukemia and lymphoma cell lines in vitro. Anticancer Drugs. 11:369–376. 2000. View Article : Google Scholar : PubMed/NCBI

24 

Soucek J and Matousek J: The binding of bull seminal ribonuclease and its carboxymethylated derivative to human leukaemic cells. Folia Biol (Praha). 25:142–144. 1979.PubMed/NCBI

25 

Lomax JE, Eller CH and Raines RT: Rational design and evaluation of mammalian ribonuclease cytotoxins. Methods Enzymol. 273–290. 2012. View Article : Google Scholar : PubMed/NCBI

26 

Matousek J, Soucek J, Riha J, Zankel TR and Benner SA: Immunosuppressive activity of angiogenin in comparison with bovine seminal ribonuclease and pancreatic ribonuclease. Comp Biochem Phys B Biochem Mol Biol. 112:235–241. 1995. View Article : Google Scholar : PubMed/NCBI

27 

Gómez-Gómez L, Rubio-Moraga A and Ahrazem O: Molecular cloning and characterisation of a pathogenesis-related protein CsPR10 from Crocus sativus. Plant Biol. 13:297–303. 2011.PubMed/NCBI

28 

Choudhary NL, Yadav OP and Lodha ML: Ribonuclease, deoxyribonuclease, and antiviral activity of Escherichia coli-expressed Bougainvillea xbuttiana antiviral protein 1. Biochemistry (Mosc). 73:273–277. 2008. View Article : Google Scholar : PubMed/NCBI

29 

Kwon YC, Kang JI, Hwang SB and Ahn BY: The ribonuclease L-dependent antiviral roles of human 2′,5′-oligoadenylate synthetase family members against hepatitis C virus. FEBS Lett. 587:156–164. 2013.

30 

Nomura H, Inokuchi N, Kobayashi H, Koyama T, Iwama M, Ohgi K and Irie M: Purification and primary structure of a new guanylic acid specific ribonuclease from Pleurotus ostreatus. J Biochem. 116:26–33. 1994.PubMed/NCBI

31 

Ye XY and Ng TB: Purification and characterization of a new ribonuclease from fruiting bodies of the oyster mushroom Pleurotus ostreatus. J Pept Sci. 9:120–124. 2003. View Article : Google Scholar : PubMed/NCBI

32 

Watanabe H, Fauzi H, Iwama M, Onda T, Ohgi K and Irie M: Base non-specific acid ribonuclease from Irpex lacteus, primary structure and phylogenetic relationships in RNase T2 family enzyme. Biosci Biotechnol Biochem. 59:2097–2103. 1995.PubMed/NCBI

33 

Wang H and Ng TB: Isolation of a new ribonuclease from fresh fruiting bodies of the straw mushroom. Biochem Biophys Res Commun. 264:714–718. 1999. View Article : Google Scholar : PubMed/NCBI

34 

Wang HX and Ng TB: Purification and characterization of a potent homodimeric guanine-specific ribonuclease from fresh mushroom (Pleurotus tuber-regium) sclerotia. Int J Biochem Cell Biol. 33:483–490. 2001. View Article : Google Scholar : PubMed/NCBI

35 

Ye XY and Ng TB: A novel and potent ribonuclease from fruiting bodies of the mushroom Pleurotus pulmonarius. Biochem Biophys Res Commun. 293:857–861. 2002. View Article : Google Scholar : PubMed/NCBI

36 

Ngai P, Wang HX and Ng TB: Purification and characterization of a ubiquitin-like peptide with macrophage stimulating, antiproliferative and ribonuclease activities from the mushroom Agrocybe cylindracea. Peptides. 24:639–645. 2003. View Article : Google Scholar : PubMed/NCBI

37 

Wang H and Ng TB: A ribonuclease with distinctive features from the wild green-headed mushroom Russulus virescens. Biochem Biophys Res Commun. 312:965–968. 2003. View Article : Google Scholar : PubMed/NCBI

38 

Wang HX and Ng TB: Isolation of a ribonuclease from fruiting bodies of the wild mushroom Termitomyces globulus. Peptides. 24:973–977. 2003. View Article : Google Scholar : PubMed/NCBI

39 

Wang HX, Ngai HK and Ng TB: A ubiquitin-like peptide with ribonuclease activity against various polyhomoribonucleotides from the yellow mushroom Cantharellus cibarius. Peptides. 24:509–513. 2003. View Article : Google Scholar : PubMed/NCBI

40 

Ngai P and Ng TB: A ribonuclease with antimicrobial, antimitogenic and antiproliferative activities from the edible mushroom Pleurotus sajor-caju. Peptides. 25:11–17. 2004. View Article : Google Scholar : PubMed/NCBI

41 

Wang HX, Ng TB and Chiu SW: A distinctive ribonuclease from fresh fruiting bodies of the medicinal mushroom Ganoderma lucidum. Biochem Bioph Res Commun. 314:519–522. 2004. View Article : Google Scholar : PubMed/NCBI

42 

Wang H and Ng TB: Isolation of a new ribonuclease from fruiting bodies of the silver plate mushroom Clitocybe maxima. Peptides. 25:935–939. 2004. View Article : Google Scholar : PubMed/NCBI

43 

Wang HX and Ng TB: Purification of a novel ribonuclease from dried fruiting bodies of the edible wild mushroom Thelephora ganbajun. Biochem Bioph Res Commun. 324:855–859. 2004. View Article : Google Scholar : PubMed/NCBI

44 

Wang HX and Ng TB: A ribonuclease from the wild mushroom Boletus griseus. Appl Microbiol Biotechnol. 72:912–916. 2006. View Article : Google Scholar

45 

Guan GP, Wang HX and Ng TB: A novel ribonuclease with antiproliferative activity from fresh fruiting bodies of the edible mushroom Hypsizigus marmoreus. Biochim Biophys Acta. 1770:1593–1597. 2007. View Article : Google Scholar : PubMed/NCBI

46 

Zhao S, Zhao Y, Li S, Zhang G, Wang H and Ng TB: Zhao S, Zhao YC, Li SH, Zhang GQ, Wang HX and Ng TB: An antiproliferative ribonuclease from fruiting bodies of the wild mushroom Russula delica. J Microbiol Biotechnol. 20:693–699. 2010. View Article : Google Scholar : PubMed/NCBI

47 

Zhang RY, Zhang GQ, Hu DD, Wang HX and Ng TB: A novel ribonuclease with antiproliferative activity from fresh fruiting bodies of the edible mushroom Lyophyllum shimeiji. Biochem Genet. 48:658–668. 2010. View Article : Google Scholar : PubMed/NCBI

48 

Laemmli UK and Favre M: Maturation of the head of bacteriophage T4. IDNA packaging events. J Mol Biol. 80:575–599. 1973. View Article : Google Scholar : PubMed/NCBI

49 

Collins RA, Ng TB, Fong WP, Wan CC and Yeung HW: A comparison of human immunodeficiency virus type 1 inhibition by partially purified aqueous extracts of Chinese medicinal herbs. Life Sci. 60:PL345–351. 1997. View Article : Google Scholar : PubMed/NCBI

50 

Wu X, Zheng SY, Cui L, Wang H and Ng TB: Isolation and characterization of a novel ribonuclease from the pink oyster mushroom Pleurotus djamor. J Gen Appl Microbiol. 56:231–239. 2010. View Article : Google Scholar : PubMed/NCBI

51 

Ng TB and Wang HX: A novel ribonuclease from fruiting bodies of the common edible mushroom Pleurotus eryngii. Peptides. 25:1365–1368. 2004. View Article : Google Scholar : PubMed/NCBI

52 

Wang HX and Ng TB: A novel ribonuclease from the veiled lady mushroom Dictyophora indusiata. Biochem Cell Biol. 81:373–377. 2003. View Article : Google Scholar : PubMed/NCBI

53 

Zhu Y, Chen G, Lv F, Wang X, Ji X, Xu Y, Sun J, Wu L, Zheng YT and Gao G: Zinc-finger antiviral protein inhibits HIV-1 infection by selectively targeting multiply spliced viral mRNAs for degradation. Proc Natl Acad Sci USA. 38:15834–15839. 2011. View Article : Google Scholar : PubMed/NCBI

54 

Li HC, Huang EY, Su PY, Wu SY, Yang CC, Lin YS, Chang WC and Shih C: Nuclear export and import of human hepatitis B virus capsid protein and particles. PLoS Pathog. 6:e10011622010. View Article : Google Scholar : PubMed/NCBI

55 

Böttcher M and Grosse F: HIV-1 protease inhibits its homologous reverse transcriptase by protein-protein interaction. Nucleic Acids Res. 25:1709–1714. 1997.PubMed/NCBI

56 

Wong JH, Legowska A, Rolka K, Ng TB, Hui M, Cho CH, Lam WW, Au SW, Gu OW and Wan DC: Effects of cathelicidin and its fragments on three key enzymes of HIV-1. Peptides. 6:1117–1122. 2011. View Article : Google Scholar : PubMed/NCBI

57 

Michaelis M, Cinatl J, Cinatl J, Pouckova P, Langer K, Kreuter J and Matousek J: Coupling of the antitumoral enzyme bovine seminal ribonuclease to polyethylene glycol chains increases its systemic efficacy in mice. Anticancer Drugs. 13:149–154. 2002. View Article : Google Scholar : PubMed/NCBI

58 

Nasu M, Carbone M, Gaudino G, Ly BH, Bertino P, Shimizu D, Morris P, Pass HI and Yang H: Ranpirnase interferes with NF-κB pathway and MMP9 activity, inhibiting malignant mesothelioma cell invasiveness and xenograft growth. Genes Cancer. 2:576–584. 2011.PubMed/NCBI

59 

Xia L, Chu KT and Ng TB: A low-molecular mass ribonuclease from the brown oyster mushroom. J Pept Res. 66:1–8. 2005. View Article : Google Scholar : PubMed/NCBI

60 

Wu Y, Wang H and Ng T: Purification and characterization of a novel RNase with antiproliferative activity from the mushroom Lactarius flavidulus. J Antibiot (Tokyo). 65:67–72. 2012. View Article : Google Scholar : PubMed/NCBI

61 

Lam SK and Ng TB: Isolation of a novel thermolabile heterodimeric ribonuclease with antifungal and antiproliferative activities from roots of the sanchi ginseng Panax notoginseng. Biochem Biophys Res Commun. 285:419–423. 2001. View Article : Google Scholar : PubMed/NCBI

Related Articles

  • Abstract
  • View
  • Download
  • Twitter
Copy and paste a formatted citation
Spandidos Publications style
Zhang R, Zhao L, Wang H and Ng TB: A novel ribonuclease with antiproliferative activity toward leukemia and lymphoma cells and HIV-1 reverse transcriptase inhibitory activity from the mushroom, Hohenbuehelia serotina . Int J Mol Med 33: 209-214, 2014.
APA
Zhang, R., Zhao, L., Wang, H., & Ng, T.B. (2014). A novel ribonuclease with antiproliferative activity toward leukemia and lymphoma cells and HIV-1 reverse transcriptase inhibitory activity from the mushroom, Hohenbuehelia serotina . International Journal of Molecular Medicine, 33, 209-214. https://doi.org/10.3892/ijmm.2013.1553
MLA
Zhang, R., Zhao, L., Wang, H., Ng, T. B."A novel ribonuclease with antiproliferative activity toward leukemia and lymphoma cells and HIV-1 reverse transcriptase inhibitory activity from the mushroom, Hohenbuehelia serotina ". International Journal of Molecular Medicine 33.1 (2014): 209-214.
Chicago
Zhang, R., Zhao, L., Wang, H., Ng, T. B."A novel ribonuclease with antiproliferative activity toward leukemia and lymphoma cells and HIV-1 reverse transcriptase inhibitory activity from the mushroom, Hohenbuehelia serotina ". International Journal of Molecular Medicine 33, no. 1 (2014): 209-214. https://doi.org/10.3892/ijmm.2013.1553
Copy and paste a formatted citation
x
Spandidos Publications style
Zhang R, Zhao L, Wang H and Ng TB: A novel ribonuclease with antiproliferative activity toward leukemia and lymphoma cells and HIV-1 reverse transcriptase inhibitory activity from the mushroom, Hohenbuehelia serotina . Int J Mol Med 33: 209-214, 2014.
APA
Zhang, R., Zhao, L., Wang, H., & Ng, T.B. (2014). A novel ribonuclease with antiproliferative activity toward leukemia and lymphoma cells and HIV-1 reverse transcriptase inhibitory activity from the mushroom, Hohenbuehelia serotina . International Journal of Molecular Medicine, 33, 209-214. https://doi.org/10.3892/ijmm.2013.1553
MLA
Zhang, R., Zhao, L., Wang, H., Ng, T. B."A novel ribonuclease with antiproliferative activity toward leukemia and lymphoma cells and HIV-1 reverse transcriptase inhibitory activity from the mushroom, Hohenbuehelia serotina ". International Journal of Molecular Medicine 33.1 (2014): 209-214.
Chicago
Zhang, R., Zhao, L., Wang, H., Ng, T. B."A novel ribonuclease with antiproliferative activity toward leukemia and lymphoma cells and HIV-1 reverse transcriptase inhibitory activity from the mushroom, Hohenbuehelia serotina ". International Journal of Molecular Medicine 33, no. 1 (2014): 209-214. https://doi.org/10.3892/ijmm.2013.1553
Follow us
  • Twitter
  • LinkedIn
  • Facebook
About
  • Spandidos Publications
  • Careers
  • Cookie Policy
  • Privacy Policy
How can we help?
  • Help
  • Live Chat
  • Contact
  • Email to our Support Team