Spandidos Publications Logo
  • About
    • About Spandidos
    • Aims and Scopes
    • Abstracting and Indexing
    • Editorial Policies
    • Reprints and Permissions
    • Job Opportunities
    • Terms and Conditions
    • Contact
  • Journals
    • All Journals
    • Oncology Letters
      • Oncology Letters
      • Information for Authors
      • Editorial Policies
      • Editorial Board
      • Aims and Scope
      • Abstracting and Indexing
      • Bibliographic Information
      • Archive
    • International Journal of Oncology
      • International Journal of Oncology
      • Information for Authors
      • Editorial Policies
      • Editorial Board
      • Aims and Scope
      • Abstracting and Indexing
      • Bibliographic Information
      • Archive
    • Molecular and Clinical Oncology
      • Molecular and Clinical Oncology
      • Information for Authors
      • Editorial Policies
      • Editorial Board
      • Aims and Scope
      • Abstracting and Indexing
      • Bibliographic Information
      • Archive
    • Experimental and Therapeutic Medicine
      • Experimental and Therapeutic Medicine
      • Information for Authors
      • Editorial Policies
      • Editorial Board
      • Aims and Scope
      • Abstracting and Indexing
      • Bibliographic Information
      • Archive
    • International Journal of Molecular Medicine
      • International Journal of Molecular Medicine
      • Information for Authors
      • Editorial Policies
      • Editorial Board
      • Aims and Scope
      • Abstracting and Indexing
      • Bibliographic Information
      • Archive
    • Biomedical Reports
      • Biomedical Reports
      • Information for Authors
      • Editorial Policies
      • Editorial Board
      • Aims and Scope
      • Abstracting and Indexing
      • Bibliographic Information
      • Archive
    • Oncology Reports
      • Oncology Reports
      • Information for Authors
      • Editorial Policies
      • Editorial Board
      • Aims and Scope
      • Abstracting and Indexing
      • Bibliographic Information
      • Archive
    • Molecular Medicine Reports
      • Molecular Medicine Reports
      • Information for Authors
      • Editorial Policies
      • Editorial Board
      • Aims and Scope
      • Abstracting and Indexing
      • Bibliographic Information
      • Archive
    • World Academy of Sciences Journal
      • World Academy of Sciences Journal
      • Information for Authors
      • Editorial Policies
      • Editorial Board
      • Aims and Scope
      • Abstracting and Indexing
      • Bibliographic Information
      • Archive
    • International Journal of Functional Nutrition
      • International Journal of Functional Nutrition
      • Information for Authors
      • Editorial Policies
      • Editorial Board
      • Aims and Scope
      • Abstracting and Indexing
      • Bibliographic Information
      • Archive
    • International Journal of Epigenetics
      • International Journal of Epigenetics
      • Information for Authors
      • Editorial Policies
      • Editorial Board
      • Aims and Scope
      • Abstracting and Indexing
      • Bibliographic Information
      • Archive
    • Medicine International
      • Medicine International
      • Information for Authors
      • Editorial Policies
      • Editorial Board
      • Aims and Scope
      • Abstracting and Indexing
      • Bibliographic Information
      • Archive
  • Articles
  • Information
    • Information for Authors
    • Information for Reviewers
    • Information for Librarians
    • Information for Advertisers
    • Conferences
  • Language Editing
Spandidos Publications Logo
  • About
    • About Spandidos
    • Aims and Scopes
    • Abstracting and Indexing
    • Editorial Policies
    • Reprints and Permissions
    • Job Opportunities
    • Terms and Conditions
    • Contact
  • Journals
    • All Journals
    • Biomedical Reports
      • Information for Authors
      • Editorial Policies
      • Editorial Board
      • Aims and Scope
      • Abstracting and Indexing
      • Bibliographic Information
      • Archive
    • Experimental and Therapeutic Medicine
      • Information for Authors
      • Editorial Policies
      • Editorial Board
      • Aims and Scope
      • Abstracting and Indexing
      • Bibliographic Information
      • Archive
    • International Journal of Epigenetics
      • Information for Authors
      • Editorial Policies
      • Editorial Board
      • Aims and Scope
      • Abstracting and Indexing
      • Bibliographic Information
      • Archive
    • International Journal of Functional Nutrition
      • Information for Authors
      • Editorial Policies
      • Editorial Board
      • Aims and Scope
      • Abstracting and Indexing
      • Bibliographic Information
      • Archive
    • International Journal of Molecular Medicine
      • Information for Authors
      • Editorial Policies
      • Editorial Board
      • Aims and Scope
      • Abstracting and Indexing
      • Bibliographic Information
      • Archive
    • International Journal of Oncology
      • Information for Authors
      • Editorial Policies
      • Editorial Board
      • Aims and Scope
      • Abstracting and Indexing
      • Bibliographic Information
      • Archive
    • Medicine International
      • Information for Authors
      • Editorial Policies
      • Editorial Board
      • Aims and Scope
      • Abstracting and Indexing
      • Bibliographic Information
      • Archive
    • Molecular and Clinical Oncology
      • Information for Authors
      • Editorial Policies
      • Editorial Board
      • Aims and Scope
      • Abstracting and Indexing
      • Bibliographic Information
      • Archive
    • Molecular Medicine Reports
      • Information for Authors
      • Editorial Policies
      • Editorial Board
      • Aims and Scope
      • Abstracting and Indexing
      • Bibliographic Information
      • Archive
    • Oncology Letters
      • Information for Authors
      • Editorial Policies
      • Editorial Board
      • Aims and Scope
      • Abstracting and Indexing
      • Bibliographic Information
      • Archive
    • Oncology Reports
      • Information for Authors
      • Editorial Policies
      • Editorial Board
      • Aims and Scope
      • Abstracting and Indexing
      • Bibliographic Information
      • Archive
    • World Academy of Sciences Journal
      • Information for Authors
      • Editorial Policies
      • Editorial Board
      • Aims and Scope
      • Abstracting and Indexing
      • Bibliographic Information
      • Archive
  • Articles
  • Information
    • For Authors
    • For Reviewers
    • For Librarians
    • For Advertisers
    • Conferences
  • Language Editing
Login Register Submit
  • This site uses cookies
  • You can change your cookie settings at any time by following the instructions in our Cookie Policy. To find out more, you may read our Privacy Policy.

    I agree
Search articles by DOI, keyword, author or affiliation
Search
Advanced Search
presentation
Molecular Medicine Reports
Join Editorial Board Propose a Special Issue
Print ISSN: 1791-2997 Online ISSN: 1791-3004
Journal Cover
January-2022 Volume 25 Issue 1

Full Size Image

Sign up for eToc alerts
Recommend to Library

Journals

International Journal of Molecular Medicine

International Journal of Molecular Medicine

International Journal of Molecular Medicine is an international journal devoted to molecular mechanisms of human disease.

International Journal of Oncology

International Journal of Oncology

International Journal of Oncology is an international journal devoted to oncology research and cancer treatment.

Molecular Medicine Reports

Molecular Medicine Reports

Covers molecular medicine topics such as pharmacology, pathology, genetics, neuroscience, infectious diseases, molecular cardiology, and molecular surgery.

Oncology Reports

Oncology Reports

Oncology Reports is an international journal devoted to fundamental and applied research in Oncology.

Experimental and Therapeutic Medicine

Experimental and Therapeutic Medicine

Experimental and Therapeutic Medicine is an international journal devoted to laboratory and clinical medicine.

Oncology Letters

Oncology Letters

Oncology Letters is an international journal devoted to Experimental and Clinical Oncology.

Biomedical Reports

Biomedical Reports

Explores a wide range of biological and medical fields, including pharmacology, genetics, microbiology, neuroscience, and molecular cardiology.

Molecular and Clinical Oncology

Molecular and Clinical Oncology

International journal addressing all aspects of oncology research, from tumorigenesis and oncogenes to chemotherapy and metastasis.

World Academy of Sciences Journal

World Academy of Sciences Journal

Multidisciplinary open-access journal spanning biochemistry, genetics, neuroscience, environmental health, and synthetic biology.

International Journal of Functional Nutrition

International Journal of Functional Nutrition

Open-access journal combining biochemistry, pharmacology, immunology, and genetics to advance health through functional nutrition.

International Journal of Epigenetics

International Journal of Epigenetics

Publishes open-access research on using epigenetics to advance understanding and treatment of human disease.

Medicine International

Medicine International

An International Open Access Journal Devoted to General Medicine.

Journal Cover
January-2022 Volume 25 Issue 1

Full Size Image

Sign up for eToc alerts
Recommend to Library

  • Article
  • Citations
    • Cite This Article
    • Download Citation
    • Create Citation Alert
    • Remove Citation Alert
    • Cited By
  • Similar Articles
    • Related Articles (in Spandidos Publications)
    • Similar Articles (Google Scholar)
    • Similar Articles (PubMed)
  • Download PDF
  • Download XML
  • View XML
Article Open Access

Propofol induces apoptosis and ameliorates 5‑fluorouracil resistance in OSCC cells by reducing the expression and secretion of amphiregulin

  • Authors:
    • Kung-Ssu Yang
    • Pi-Cheng Che
    • Ming-Ju Hsieh
    • I-Neng Lee
    • Yu-Ping Wu
    • Ming-Shan Chen
    • Jui-Chieh Chen
  • View Affiliations / Copyright

    Affiliations: Department of Anesthesiology, Ditmanson Medical Foundation Chia‑Yi Christian Hospital, Chiayi 60002, Taiwan, R.O.C., Cancer Research Center, Changhua Christian Hospital, Changhua 500209, Taiwan, R.O.C., Department of Medical Research, Chang Gung Memorial Hospital, Chiayi 61363, Taiwan, R.O.C., Department of Biochemical Science and Technology, National Chiayi University, Chiayi 60004, Taiwan, R.O.C.
    Copyright: © Yang et al. This is an open access article distributed under the terms of Creative Commons Attribution License.
  • Article Number: 36
    |
    Published online on: December 1, 2021
       https://doi.org/10.3892/mmr.2021.12552
  • Expand metrics +
Metrics: Total Views: 0 (Spandidos Publications: | PMC Statistics: )
Metrics: Total PDF Downloads: 0 (Spandidos Publications: | PMC Statistics: )
Cited By (CrossRef): 0 citations Loading Articles...

This article is mentioned in:



Abstract

Among the different types of oral cancer, >90% of cases are oral squamous cell carcinoma (OSCC). 5‑fluorouracil (5‑FU) is a commonly used treatment for OSCC, but cells typically display resistance to the drug. Propofol, an intravenous anesthetic agent, exhibits certain anticancer effects, including the inhibition of cancer cell proliferation, migration and invasion. Secreted proteins, such as growth factors and cytokines are involved in cancer development and progression, but the effect of propofol on secreted proteins in OSCC is not completely understood. An MTT assay, flow cytometry and western blotting were performed to determine the anticancer effects of propofol. The secretion profile of OSCC was determined using an antibody array, and clinical importance was assessed using the Gene Expression Profiling Interactive Analysis database. The results were verified by performing reverse transcription‑quantitative PCR (RT‑qPCR) and western blotting. 5‑FU‑resistant cells were established to determine the role of the gene of interest in drug resistance. The results demonstrated that propofol decreased cell viability and promoted cell apoptosis. The antibody array results showed that propofol attenuated the secretion of multiple growth factors. The bioinformatics results indicated that amphiregulin (AREG) was expressed at significantly higher levels in cancer tissues, which was also related to poor prognosis. The results of RT‑qPCR and western blotting revealed that propofol decreased AREG expression. Pretreatment with exogenous recombinant AREG increased EGFR activation and conferred propofol resistance. Moreover, the results indicated that the expression and activation of AREG was also related to 5‑FU resistance, but propofol ameliorated 5‑FU drug resistance. Therefore, the present study suggested that propofol combination therapy may serve as an effective treatment strategy for OSCC.

Introduction

Oral squamous cell carcinoma (OSCC) is the most common subset of head and neck squamous cell carcinoma (HNSCC) (1). Clinical treatment of OSCC includes surgery, radiotherapy and chemotherapy (2). Multiple treatment strategies have improved the clinical outcome for patients with OSCC, but the overall 5-year survival rate after diagnosis is still <50% (3). As with other solid tumors, 5-fluorouracil (5-FU) is one of the most effective and commonly used drugs for OSCC (4), but its clinical effectiveness is often limited due to acquired resistance with continuous drug administration (5). Therefore, identifying an effective therapeutic drug to improve the prognosis of patients with OSCC is important.

Propofol (2, 6-diisopropylphenol) is a commonly used intravenous sedative-hypnotic drug that allows for smooth induction and a rapid recovery from anesthesia (6). Propofol also displays a number of non-anesthetic effects, including antitumor activities (7,8). In a variety of human cancer cells, it has been reported that propofol triggers cell apoptosis and inhibits proliferation, migration and invasion (9,10). Certain retrospective studies and prospective trials have reported that propofol treatment improves the survival outcomes for patients with certain types of cancer after tumor resection (11–16). However, the role of propofol in the treatment of OSCC is not completely understood.

Secreted substances are responsible for communication between cells and may promote tumor progression (17). Increasing evidence demonstrates that the microenvironment is the primary driver for cancer growth, motility and therapy resistance (18–20). Secretions from cells can also enter the blood system and serve as serum tumor markers. A recent study showed that for patients undergoing radical resection for non-small cell lung cancer (NSCLC), propofol reduced postoperative serum tumor angiogenesis-related factors, such as VEGF and TGF-β (21), thus propofol may affect the tumor microenvironment and serve a pivotal role in the development and progression of cancer.

Antibody arrays are extensively utilized in cancer research to identify candidate biomarkers and explore signaling pathways, which benefits diagnosis, prognosis and treatment (22). Numerous biological websites and software can be used for bioinformatics analysis, including gene expression profile interactive analysis (GEPIA) (23), which has been successfully applied in numerous cancer studies. The present study investigated the effect of propofol on OSCC cytotoxicity and the secreted protein profile using an antibody array. Bioinformatics tools are used to evaluate the clinical importance of these altered secreted proteins.

Materials and methods

Chemicals and reagents

Propofol (purity >98%) was obtained from The United States Pharmacopeial Convention. 5-FU was purchased from Sigma-Aldrich (Merck KGaA). Propofol and 5-FU were dissolved in DMSO (Amresco, LLC) and stored at 4°C before use. Recombinant AREG (rAREG) was purchased from R&D Systems, Inc.

Cell culture

Human OSCC cell lines (SAS and SCC9) were cultured in DMEM (Gibco; Thermo Fisher Scientific, Inc.) containing 10% FBS (Gibco; Thermo Fisher Scientific, Inc.) and 1% penicillin-streptomycin, and maintained at 37°C in a humidified atmosphere of 5% CO2.

Cell cytotoxicity

The cytotoxic activity of propofol on OSCC cells was assessed using an MTT assay. Cells (5×103/well) in 100 µl medium were plated in each well of a 96-well plate overnight. Subsequently, cells were treated with the indicated concentrations of propofol (0, 5, 10, 20, 40, 80 and 160 µM) or 5-FU (0–160 µM) for the indicated interval (24, 48 or 72 h). Then, MTT reagent (5 mg/ml in PBS) was added to each well and incubated for 4 h. The supernatant was removed and 100 µl DMSO was added to each well to dissolve the formazan crystals. The absorbance was measured at a wavelength of 550 nm using a microplate reader, and the background value at a wavelength of 750 nm was subtracted. Cell viability is presented as the percentage relative to untreated cells.

Detection of the apoptotic rate by flow cytometry

Cells (1.5×105 cells/well) were seeded into 6 well plates and cultured overnight. After treatment with 160 µM propofol for 48 h at 37°C, cells were collected and washed with cold PBS. The Annexin V FITC/PI Apoptosis Detection kit (BD Biosciences) was used to detect cell apoptosis. After staining at 25°C in the dark for 15 min, the apoptotic rate was determined by BD FACSCanto™ II flow cytometer (BD Biosciences). Data acquisition was performed using FACSDiva software version 6.1 (BD Biosciences). The apoptotic rate (%) was calculated as the sum of Annexin-V-FITC+/PI− (early apoptosis; Q4) and Annexin-V-FITC+/PI+ (late apoptosis; Q4) cells.

Western blotting

Total protein was isolated from cells using RIPA buffer supplemented with a protease inhibitor cocktail. A Pierce BCA Protein Assay Kit (Thermo Fisher Scientific, Inc.) was used to determine protein concentrations. Equal amounts of total protein (40 µg/lane) were separated by SDS-PAGE (8–15% gel) and then transferred to PVDF membranes (Millipore). After blocking with 5% skimmed milk in TBS at room temperature for 1 h, the membranes were incubated with specific primary antibodies overnight at 4°C. The following primary antibodies were used: Cleaved PARP (1:2,000; cat. no. ab32064; Abcam), α-tubulin (1:10,000; cat. no. 05–829; EMD Millipore), AREG (1:200; cat. no. sc-74501; Santa Cruz Biotechnology, Inc.), phosphorylated (p)-EGFR (1:1,000; cat. no. 6963S; Cell Signaling Technology, Inc.), and EGFR (1: 200; cat. no. sc-53274; Santa Cruz Biotechnology, Inc.). After several washes with TBST (0.05% Tween-20), the membranes were then incubated for 1 h with appropriate HRP-conjugated goat anti-rabbit IgG (1:5,000; cat. no. 20202; Leadgene Biomedical, Inc.) and goat anti-mouse IgG (1:5,000; cat. no. 115-035-003; Jackson ImmunoResearch Laboratories, Inc.) secondary antibodies. The membranes were then washed with TBST and protein bands were visualized using ECL reagents (Merck KGaA) and autoradiography. The intensity of signals was recorded using UN-SCAN-IT gel 6.1 software (Silk Scientific, Inc.).

Preparation of conditioned media (CM)

Cells were cultured in DMEM until they reached 70% confluence. The adherent cells were washed three times with PBS to remove FBS, and then cultured in serum-free DMEM for 48 h. The culture media was collected, centrifuged at 500 × g at room temperature for 15 min and then carefully aspirated to collect the CM. Amicon® Ultra (Merck KGaA) with a 3 kDa cut-off value was used to increase the protein concentration by centrifugation at 2,000 × g at 4°C for 3 h. The resultant CM was stored at −80°C until further use. An equal amount of conditioned culture media (40 µg) was analyzed by 15% SDS-PAGE and transferred to PVDF membrane, after which the membrane was stained with Ponceau S at room temperature for 5 min as a loading control.

Human growth factor antibody array

An Human Growth Factor Antibody Array Membrane (41 Targets; cat. no. ab134002; Abcam) containing 41 targets was used to determine changes in secreted proteins after propofol treatment. The membrane was blocked by incubating at room temperature for 30 min with 1X blocking buffer (provided in the kit). The array membrane was incubated with 200 µg concentrated CM sample overnight at 4°C. After washing (reagent provided in the kit), the membrane was incubated with the primary antibody cocktail for overnight at 4°C, washed and then incubated with the secondary antibody for 2 h at room temperature. Subsequently, bound antibodies were visualized using ECL reagents. The primary antibody cocktail, secondary antibody and ECL reagents were all provided as part of the array kit. The relative intensity of the signal was calculated using UN-SCAN-IT gel 6.1 software (Silk Scientific, Inc.). The background (negative control) was subtracted from the intensity of the dot signal and normalized using the average value for the positive control spots.

GEPIA analysis

GEPIA is an online web server that uses The Cancer Genome Atlas (TCGA) and Genotype-Tissue Expression (GTEx) data. The TCGA included the RNA-Seq data of 9,736 tumor samples with 33 cancer types and 726 adjacent normal tissues. GTEx included the RNA-Seq data of >8,000 normal samples. The datasets were both stored in a MySQL relational database (version 5.7.17) (23). The present study used GEPIA to determine the clinical importance of the candidate genes identified by the antibody array. The gene name was set as ‘AREG’ and ‘HNSCC’ datasets were used for the analysis. The expression data were the first log2 (TPM+1) transformed data that were used for differential analysis. The log2FC was defined as median (tumor) - median (normal). The |Log2FC| cutoff was 1. The cutoff value for P was 0.05. Log2 (TPM+1) where TPM = Transcripts Per Million was used for the log-scale. Whisker plots show the relative RNA expression for candidate genes between HNSCC tissues (n=519) and normal tissues (n=44). GEPIA was also used to determine the relationship between the expression level for candidate genes and overall survival (OS) for patients with HNSCC.

Reverse transcription-quantitative PCR (qPCR)

Total RNA was extracted from cells using TRIzol® reagent (Thermo Fisher Scientific, Inc.). RNA was reverse transcribed into cDNA using the PrimeScript RT Reagent kit (Takara Bio, Inc.) according to the manufacturer's protocol. Subsequently, qPCR was performed using Kapa SYB® FAST qPCR Master Mix (Takara Bio, Inc.) and the MyGo PCR detection system (IT-IS Life Science Ltd.). The thermocycling conditions were as follows: Initial denaturation at 95°C for 180 sec, followed by 40 cycles at 95°C for 10 sec, 60°C for 20 sec and 72°C for 30 sec. The following primers were used for qPCR: AREG forward, 5′-ACCTACTCTGGGAAGCGTGA-3′ and reverse, 5′-GGACTTTTCCCCACACCGTT-3′; and GAPDH forward, 5′-CACCCATGGCAAATTCCATGGCA-3′ and reverse, 5′-TCTAGACGGCAGGTCAGGTCCACC-3′. AREG mRNA expression was quantified using the 2−∆∆Cq method and normalized to the internal reference gene GAPDH (24).

Human EGFR phosphorylation antibody array

Cells were pre-starved in serum-free DMEM for 4 h, and then stimulated for 15 min with serum-free DMEM containing human rAREG protein (50 ng/ml; R&D Systems, Inc.) at 37°C. A Human EGFR Phosphorylation Antibody Array-Membrane (17 Targets; cat. no. ab134005; Abcam) was used to determine changes in EGFR activation after rAREG treatment. The membrane was blocked by incubating at room temperature for 1 h with 1X blocking buffer (provided in the kit). The array membrane was then incubated with cell lysates (200 µg/ml) overnight at 4°C. After washing (reagent provided in the kit), the membrane was incubated with a biotin-conjugated anti-EGFR cocktail (reagent provided in the kit) overnight at 4°C, washed (reagent provided in the kit) and subsequently incubated with the HRP-conjugated streptavidin for 2 h at room temperature. The signals are visualized using ECL reagents (provided in the kit) and autoradiography. In addition, SAS and SCC9 cells were treated with rAREG (50–100 ng/ml) and analyzed by western blot to verify the activation of EGFR.

Establishment of 5-FU-resistant (FUR) sublines

To determine the mechanism underlying 5-FU resistance, SCC9 cells were cultured in the completed medium with gradually increasing concentrations of 5-FU from 0.5 to 160 µM. After ~6 months, cells survived in three different concentrations of 5-FU (40, 80 and 160 µM). Cells with different levels of 5-FU-resistance were named SCC9-FUR40, SCC9-FUR80 and SCC9-FUR160 cells, respectively.

AREG overexpression

SCC9 cells were seeded at a density of 3×105 cells/6 cm culture dish, after which cells were cultured in completed medium overnight at 37°C with 5% CO2. SCC9 cells were transfected with AREG overexpression plasmid (1 µg; pCMV3-AREG) or empty vector (1 µg; pCMV3) using TurboFect transfection reagent (Thermo Fisher Scientific, Inc.). Following overnight incubation at 37°C, the medium was replaced with fresh complete medium, and the cells received a second incubation of 24 h at 37°C. All plasmids were purchased from Sino Biological Inc. The amino acid sequence of AREG overexpression was as follows: MRAPLLPPAPVVLSLLILGSGHYAAGLDLNDTYSGKREPFSGDHSADGFEVTSRSEMSSGSEISPVSEMPSSSEPSSGADYDYSEEYDNEPQIPGYIVDDSVRVEQVVKPPQNKTESENTSDKPKRKKKGGKNGKNRRNRKKKNPCNAEFQNFCIHGECKYIEHLEAVTCKCQQEYFGERCGEKSMKTHSMIDSSLSKIALAAIAAFMSAVILTAVAVITVQLRRQYVRKYEGEAEERKKLRQENGNVHAIA. After transfection, cells were cultured for 48 h and then harvested to determine the transfection efficiency via western blotting. The effect of AREG overexpression on 5-FU sensitivity was also determined using a MTT assay.

Statistical analysis

Data are presented as the mean ± SEM of at least three independent experiments. Statistical analyses were performed using GraphPad Prism software (version 6.0; GraphPad Software, Inc.). Comparisons between two groups were analyzed using the unpaired Student's t-test. Comparisons among multiple groups were analyzed using one-way ANOVA followed by Bonferroni's post hoc test. P<0.05 was considered to indicate a statistically significant difference.

Results

Effect of propofol on anticancer activity in OSCC cells

To determine the cytotoxic effect of propofol on OSCC cells, SAS and SCC9 cells were incubated in media containing 0–160 µM propofol for 48 h, and then cell viability was determined using an MTT assay. As shown in Fig. 1A, propofol decreased OSCC cell viability in a dose-dependent manner; however, significance was only recorded at concentrations >5 µM. To determine whether propofol induced OSCC cell apoptosis, Annexin V-FITC/PI staining-based flow cytometry was conducted to detect SAS and SCC9 cell apoptosis following treatment with propofol. Compared with the control groups (12.73±0.7126 and 17.02±1.337%, respectively), propofol significantly increased the proportion of apoptotic cells in both SAS (18.33±1.410%) and SCC9 (27.78±1.827%) cells (Fig. 1B).

Figure 1.

Propofol decreases oral squamous cell carcinoma cell viability and promotes cell apoptosis. (A) Effect of propofol on SAS (n=4) and SCC9 (n=3) cell viability. Cells were treated with 0–160 µM propofol for 48 h and then cell viability assay was determined using MTT assays. (B) Cells were treated with 160 µM propofol for 48 h. Apoptosis was evaluated by Annexin V-FITC/PI staining and the ratio of apoptotic cells was quantified using flow cytometry. (SAS cells, n=3; SCC9 cells, n=5) (C) Effect of propofol on cleaved PARP protein expression levels was determined by western blotting with α-tubulin as the loading control (n=3). Cells were treated with increasing doses of propofol (0–160 µM) for 48 h. *P<0.05 vs. control. PARP, poly(ADP-ribose) polymerase.

The expression levels of cleaved- poly(ADP-ribose) polymerase (PARP), a protein that is associated with apoptosis (25), were determined by western blotting to assess the effect of propofol on cell apoptosis. The results demonstrated that propofol treatment increased the expression of cleaved PARP increased in a concentration-dependent manner (Fig. 1C).

Propofol attenuates the secretion of multiple growth factors in OSCC cells

Numerous studies have demonstrated that growth factors secreted by tumor cells into the microenvironment are related to antiapoptosis effects (19,26). To determine the effect of propofol on the secretion of growth factors, CM was used for an antibody array to detect changes in the secretion of growth factors by OSCC cells after treatment with propofol (Fig. 2A). The relative signal intensity for the growth factors was compared between untreated and propofol-treated SAS and SCC9 cells. SAS and SCC9 cells displayed similar results, with a total of 16 growth factors [AREG, basic fibroblast growth factor, beta-nerve growth factor, EGF, FGF-4, FGF-6, insulin like growth factor binding protein-4, insulin like growth factor-1, neurotrophin (NT)-3, NT-4, platelet derived growth factor receptor (PDGF R)α, PDGF Rβ, TGFβ, TGFβ3, VEGFR2 and VEGFR3] displaying a >2-fold reduction in secretion in the propofol-treated group compared with the untreated group (Fig. 2B).

Figure 2.

Effect of propofol on protein secretion in oral squamous cell carcinoma cells. (A) Cells were treated with 10 µM propofol for 48 h. Untreated cells were used as controls. Serum-free conditioned media was harvested and analyzed using a human growth factor antibody array. Each antibody was spotted in duplicate onto a membrane. The boxes with numbers indicate that the spots that were markedly reduced in size in the propofol-treated group compared with the untreated group (fold changes >2). (B) With reference to untreated cells, the intensity of the spots was quantified by densitometry analysis and displayed as a relative signal intensity. AREG, amphiregulin; b-FGF, basic fibroblast growth factor; b-NGF, beta-nerve growth factor; IGFBP, insulin like growth factor binding protein; IGF, insulin like growth factor; NT, neurotrophin; PDGF R, platelet derived growth factor receptor.

Bioinformatics analysis of the clinical significance of the downregulation of secreted proteins in patients with HNSCC

To determine the clinical importance of these secreted proteins, GEPIA were used to determine differences in expression patterns between HNSCC tissues and healthy tissues. Compared with those in healthy tissues, the mRNA expression levels of AREG, PDGF Rβ, TGF-β and TGF-β3 were significantly upregulated in HNSCC tissues, whereas NT-3 was significantly downregulated (Fig. 3A).

Figure 3.

Association between decreased protein secretion and the clinical features of HNSCC. (A) Box plots indicating mRNA expression levels for candidate genes in HNSCC tissues (red) and normal tissue (gray) for The Cancer Genome Atlas datasets from GEPIA. The y-axes represent transformed log2 (TPM+1). The |log2FC| cutoff was 1 and the P-value cutoff was 0.05. (B) Association between target genes and overall survival was determined using GEPIA. The solid line represents the survival curve and the dashed lines represents the 95% confidence interval. Log-rank P<0.05 was considered to indicate a statistically significant difference. Patients with expression levels higher than the median are indicated by a red line and patients with expression levels lower than the median are indicated by a blue line. *P<0.05. HNSCC, head and neck squamous cell carcinoma; GEPIA, gene expression profile interactive analysis; TPM, transcripts per million; FC, fold change; HR, hazard ratio; b-FGF, basic fibroblast growth factor; b-NGF, beta-nerve growth factor; IGFBP, insulin like growth factor binding protein; IGF, insulin like growth factor; NT, neurotrophin; PDGF R, platelet derived growth factor receptor.

GEPIA was also used to perform an OS analysis to determine the clinical relevance of these secreted proteins in terms of prognosis. The results demonstrated that high mRNA expression of AREG (log-rank P=0.00039) and EGF (log-rank P=0.00087) was significantly associated with a worse OS (Fig. 3B). However, high expression levels of PDGF Rα (log-rank P=0.024), VEGFR2 (log-rank P=0.025) and VEGFR (log-rank P=0.036) were significantly associated with an improved prognosis for patients with HNSCC. The bioinformatics analysis results demonstrated that AREG was highly expressed in cancer tissues and associated with a poor prognosis, thus AREG was selected as the target gene for the present study.

Propofol reduces AREG expression in OSCC cells and may limit the activation of its related signaling pathways

The effect of propofol on AREG expression was investigated. SAS and SCC9 cells were treated with different concentrations of propofol (0–160 µM). The results demonstrated that the mRNA expression level of AREG was significantly reduced at 160 µM in SAS cells and significantly reduced at 20 µM in SCC9 cells. (Fig. 4A). After propofol treatment, the effect of propofol on AREG protein expression was significantly reduced in a dose-dependent manner in both SAS and SCC9 cells. (Fig. 4B). The activation of specific kinases via extracellular stimulation of AREG may serve a crucial role in mediating cell functions. Therefore, OSCC cells were treated with rAREG, and a human EGFR phosphorylation antibody array was used to determine the relative phosphorylation levels for 17 different EGF receptors.

Figure 4.

Propofol inhibits AREG expression in oral squamous cell carcinoma cells, which may reduce the activation of its related signaling pathways and lead to cell apoptosis. (A) mRNA and (B) protein expression levels of AREG were determined by reverse transcription-quantitative PCR (n=4-6) and western blotting (n=3), respectively. SAS and SCC9 cells were treated with propofol (10–160 µM) for 48 h. *P<0.05 vs. untreated control. (C) SAS and SCC9 cells were stimulated with or without rAREG (50 ng/ml) for 15 min. The activation of EGFR was determined using a human EGFR phosphorylation antibody array. (D) SAS and SCC9 cells were stimulated with different concentrations of rAREG (50–100 ng/ml) for 15 min and then the cell lysates were analyzed by western blotting using anti-p-EGFR (Tyr845) or anti-EGFR antibodies (n=3). (E) SAS cells were pretreated with rAREG (50 ng/ml) for 4 h and then stimulated with 40 µM propofol for 48 h (n=4). SCC9 cells were pretreated with rAREG (100 ng/ml) for 4 h and then stimulated with 80 µM propofol for 48 h (n=4). Cell viability was determined using an MTT assay (n=4). Data are presented as the mean ± SEM. *P<0.05 vs. Untreated control group; #P<0.05 vs. propofol. AREG, amphiregulin; rAREG, recombinant AREG; p, phosphorylated.

In rAREG-treated SAS cells, there was more than twice the level of phosphorylation of EGFR (Tyr845) and ErbB2 (Tyr877) and 1.5 times the level of ErbB2 (Tyr1112) compared with that in untreated SAS cells (Fig. 4C). SCC9 cells displayed similar activation behavior, with an activation efficiency greater than that of SAS cells. As shown in Fig. 4C, the phosphorylation level of EGFR (Tyr1173) and ErbB4 (Tyr1284) increased >1.5 times and the phosphorylation level for EGFR (Tyr845), ErbB2 (Tyr877) and ErbB2 (Tyr1112) increased >3-fold.

AREG is the main ligand that is responsible for EGFR signal activation (27). AREG also induced Tyr845 phosphorylation of EGFR in both SAS and SCC9 cells, so SAS and SCC9 cells were treated with increasing doses of rAREG (50–100 ng/ml) and the level of phosphorylated EGFR (Tyr845) was assessed via western blotting. AREG markedly induced EGFR (Tyr845) phosphorylation in SAS and SCC9 cells in a concentration-dependent manner (Fig. 4D).

To verify that propofol induced OSCC cell apoptosis by decreasing the expression of AREG, OSCC cells were pretreated with rAREG to assess whether this increased resistance to propofol. The results demonstrated that pretreatment with rAREG significantly increased the resistance of SAS and SCC9 cells to propofol (Fig. 4E). These results indicated that propofol suppressed the expression and secretion of AREG, which may limit AREG-induced EGFR activation and promote cell apoptosis.

Elevated AREG expression and its associated activation are related to the development of 5-FU resistance, but propofol alleviates resistance to 5-FU

To determine the relationship between AREG expression and 5-FU sensitivity in OSCC cells, different concentrations of 5-FU were used to establish cell lines with different degrees of 5-FU resistance. The results indicated that 5-FU resistance was gradually increased from SCC9, SCC9-FUR40, SCC9-FUR80 to SCC9-FUR160 cells, displaying significantly increased cell viability in SCC9-FUR160 cells compared with SCC9 cells (Fig. 5A).

Figure 5.

AREG upregulation is related to the development of 5-FU resistance, but propofol alleviates 5-FU resistance. (A) Cells were treated with 160 µM 5-FU for 48 h and then cell viability was determined by performing MTT assays. Data are presented as the mean ± SEM (n=3). *P<0.05 vs. SCC9. (B) AREG protein expression levels in 5-FU-resistant cell sub-lines and their parental cells were analyzed by western blotting with α-tubulin as the loading control (n=3). (C) Secreted levels of AREG in the cell culture media of SCC9 and SCC9-FUR160 cells were analyzed using western blotting (n=3). Ponceau S staining demonstrated that equivalent amounts of total protein were loaded on each lane. (D) Basal expression of p-EGFR and total EGFR in SCC9 and SCC9-FUR160 cells was evaluated by western blotting (n=3). (E) SCC9 cells were transiently transfected with pCMV3-AREG and then the protein expression level of AREG was analyzed by western blotting (n=3). (F) Cells were treated with increasing concentrations of propofol (0–160 µM) for 72 h. Effect of AREG overexpression on 5-FU-induced cytotoxicity was determined by performing MTT assays (n=4). *P<0.05 vs. pCMV. (G) Cells were treated with propofol (10 µM) for 24 h and then stimulated with 5-FU (40 µM) in the presence of 10 µM propofol for 48 h. Cell viability was then assessed by performing MTT assays (n=3). *P<0.05 vs. 5-FU treatment alone. AREG, amphiregulin; 5-FU, 5-fluorouracil; p, phosphorylated; FUR, 5-FU-resistant. F, 5-FU.

The levels of AREG expression were elevated as 5-FU resistance increased (Fig. 5B). SCC9 and SCC9-FUR160 cells were then compared to determine whether highly resistant cells displayed a high level of AREG secretion and activation of the related signaling pathways. SCC9-FUR160 cells displayed higher protein expression levels of AREG compared with SCC9 cells (Fig. 5C). The relative expression of total EGFR and the phosphorylation of EGFR (Tyr845) was also notably higher in SCC9-FUR160 cells compared with that in SCC9 cells (Fig. 5D).

To verify that AREG mediated 5-FU resistance, AREG overexpression vector or empty vector was used to transiently transfect SCC9 cells and then the sensitivity to 5-FU was assessed. AREG overexpression was confirmed by western blotting (Fig. 5E). The results demonstrated that AREG overexpression significantly increased resistance to 5-FU for SCC9-FUR160 cells (Fig. 5F).

To determine whether propofol increased sensitivity to 5-FU for OSCC cells, SCC9 and SCC9-FUR160 cells were pretreated with propofol for 24 h and then combined with 5-FU for another 48 h. As the antibody array analysis results showed that treatment of cells with 10 µM propofol markedly reduced the secretion of a number of growth factors, cells were treated with 10 µM propofol. Propofol slightly increased 5-FU cytotoxicity in SCC9 cells, but significantly increased sensitivity to 5-FU in SCC9-FUR160 cells compared with 5-FU alone (Fig. 5G). These results demonstrated that propofol alleviated resistance to 5-FU, potentially by decreasing the expression and secretion of AREG.

Discussion

Propofol is one of the most commonly used intravenous anesthetics in clinical practice (28). The present study aimed to determine the effect of propofol on the biological behavior and secretion of growth factors in OSCC cells. The results demonstrated that propofol was cytotoxic to OSCC cells and downregulated the secretion of several growth factors. The GEPIA database results indicated that AREG was highly expressed in cancer tissues and associated with poor prognosis for patients with OSCC, thus AREG was selected for further investigation. AREG is the ligand of EGFR (27). The results of the current study revealed that propofol downregulated the secretion of AREG, which may have reduced the activation of the EGFR pathway. To the best of our knowledge, the present study was the first to demonstrate that propofol regulated AREG to exert an antitumor effect.

AREG is one of the ligands of EGFR that is shed from the membrane through the proteolytic process of disintegrin and metalloprotease 17 (ADAM17) and is converted into an active soluble form, which activates receptors (29). Previous studies have reported that AREG upregulation is related to drug resistance and a failure of treatment for multiple types of cancer, including OSCC (30–32). EGFR in HNSCC is also 15% upregulated, and high EGFR expression is associated with a low survival rate (33). Similarly, >80% of OSCC cases exhibit EGFR upregulation, which is highly correlated with carcinogenic, antiapoptotic and aggressive phenotypes (34–36).

Increasing evidence shows that anesthetics can affect tumor progression (37) and long-term outcomes for patients (38), especially in terms of cancer recurrence (39). It has been reported that different anesthetics can have opposite effects on cancer development (40). Therefore, the identification of an appropriate anesthetic to provide adequate anesthesia management for patients with cancer is important.

Previous studies show that propofol can have an anticancer effect in different human cancer cells, including osteosarcoma (41), hepatocellular carcinoma (42), lung cancer (43), ovarian cancer (44), cervical cancer (45), glioma (46), gastric cancer (47), breast cancer (48) and colorectal cancer cells (49). A previous study showed that propofol displayed an anticancer effect on OSCC cells by inhibiting cell proliferation and promoting cell apoptosis (50). Retrospective analyses demonstrated that propofol-based total intravenous anesthesia significantly reduces postoperative mortality for patients with cancer, so propofol may be involved in tumor suppression (51,52).

Tumors are heterogeneous tissues that are surrounded by the tumor microenvironment. The complex microenvironment for a tumor is composed of cancer cells, stromal cells, immune cells and extracellular matrix. The tumor microenvironment is related to tumor progression and affects tumor growth, metastasis, drug resistance and recurrence (53). The regulation of the microenvironment for tumors has also become a new strategy for cancer treatment (54).

At present, it is known that propofol displays anti-inflammatory properties (55). The present study demonstrated that propofol decreased the secretion of a variety of growth factors, which implied that the anti-inflammatory effect of propofol may be achieved via the secretion of inflammatory factors. However, the antibody array used in the present study only analyzed the secretion of 41 growth factors in OSCC cells. To further assess the anti-inflammatory effects of propofol, future studies should select a suitable immune cell line for further analysis.

Previous studies have reported that propofol inhibits the proliferation, metastasis and progress of pancreatic cancer by inhibiting the expression of ADAM (56,57). The ADAM family is involved in the process of proteolytic shedding of membrane-associated proteins, which causes cleavage of transmembrane proteins and solubilizes the complete ectodomain of cytokines, growth factors, receptors and adhesion molecules, which changes in the tumor microenvironment (58).

A previous study also showed that propofol inhibits the release of VEGF-C, which is induced by breast surgery (59). VEGF-C has been shown to be involved in lymphangiogenesis to promote cancer metastasis. VEGF-C has also been observed to increase cell proliferation and migration, contributing to OSCC progression (60). Extracellular vesicles (EVs) are also important facilitators of malignant cell communication. Propofol has been shown to exhibit anticancer activity by inhibiting the release of EVs during a cancer resection, which is related to tumor progression and prognosis (61,62).

Numerous studies have shown that propofol may be involved in tumor suppression, displaying an important effect on the process of tumor spread and chemotherapy (8,9,28,63,64); however, the underlying molecular mechanisms are not completely understood. The present study investigated the effect of propofol on the secretion profile of growth factors by OSCC cells. To determine the clinical significance of the altered proteins, the GEPIA database was used and the results indicated that AREG was significantly elevated in cancer tissues and associated with a poor prognosis for patients with OSCC. The present study also determined that AREG expression and the activation of its related signaling pathways was involved in 5-FU-resistance in OSCC. Pretreatment with propofol increased 5-FU sensitivity in 5-FU resistant cells. Therefore, the results of the present study provided a theoretical basis for the combined use of propofol and 5-FU for the treatment of OSCC.

Acknowledgements

Not applicable.

Funding

The present study was supported by the Ditmanson Medical Foundation of Chia-Yi Christian Hospital (grant no. R109-16).

Availability of data and materials

The datasets used and/or analyzed during the current study are available from the corresponding author on reasonable request.

Authors' contributions

JCC and MSC conceived and designed the current study. KSY and PCC performed data analysis and wrote the manuscript. YPW performed the experiments. MJH and INL were responsible for data interpretation and manuscript revision. JCC revised the manuscript critically for important intellectual content. All authors have read and approved the final manuscript. JCC and MSC confirmed the authenticity of all the raw data.

Ethics approval and consent to participate

Not applicable.

Patient consent for publication

Not applicable.

Competing interests

The authors declare that they have no competing interests.

References

1 

Curado MP and Hashibe M: Recent changes in the epidemiology of head and neck cancer. Curr Opin Oncol. 21:194–200. 2009. View Article : Google Scholar : PubMed/NCBI

2 

Scully C and Bagan J: Oral squamous cell carcinoma overview. Oral Oncol. 45:301–308. 2009. View Article : Google Scholar : PubMed/NCBI

3 

Chi AC, Day TA and Neville BW: Oral cavity and oropharyngeal squamous cell carcinoma - an update. CA Cancer J Clin. 65:401–421. 2015. View Article : Google Scholar : PubMed/NCBI

4 

Longley DB, Harkin DP and Johnston PG: 5-fluorouracil: Mechanisms of action and clinical strategies. Nat Rev Cancer. 3:330–338. 2003. View Article : Google Scholar : PubMed/NCBI

5 

Nagata M, Nakayama H, Tanaka T, Yoshida R, Yoshitake Y, Fukuma D, Kawahara K, Nakagawa Y, Ota K, Hiraki A, et al: Overexpression of cIAP2 contributes to 5-FU resistance and a poor prognosis in oral squamous cell carcinoma. Br J Cancer. 105:1322–1330. 2011. View Article : Google Scholar : PubMed/NCBI

6 

Sahinovic MM, Struys MMRF and Absalom AR: Clinical Pharmacokinetics and Pharmacodynamics of Propofol. Clin Pharmacokinet. 57:1539–1558. 2018. View Article : Google Scholar : PubMed/NCBI

7 

Vasileiou I, Xanthos T, Koudouna E, Perrea D, Klonaris C, Katsargyris A and Papadimitriou L: Propofol: A review of its non-anaesthetic effects. Eur J Pharmacol. 605:1–8. 2009. View Article : Google Scholar : PubMed/NCBI

8 

Song J, Shen Y, Zhang J and Lian Q: Mini profile of potential anticancer properties of propofol. PLoS One. 9:e1144402014. View Article : Google Scholar : PubMed/NCBI

9 

Gong T, Ning X, Deng Z, Liu M, Zhou B, Chen X, Huang S, Xu Y, Chen Z and Luo R: Propofol-induced miR-219-5p inhibits growth and invasion of hepatocellular carcinoma through suppression of GPC3-mediated Wnt/β-catenin signalling activation. J Cell Biochem. 120:16934–16945. 2019. View Article : Google Scholar : PubMed/NCBI

10 

Ye LL, Cheng ZG, Cheng XE and Huang YL: Propofol regulates miR-1-3p/IGF1 axis to inhibit the proliferation and accelerates apoptosis of colorectal cancer cells. Toxicol Res (Camb). 10:696–705. 2021. View Article : Google Scholar : PubMed/NCBI

11 

Jun IJ, Jo JY, Kim JI, Chin JH, Kim WJ, Kim HR, Lee EH and Choi IC: Impact of anesthetic agents on overall and recurrence-free survival in patients undergoing esophageal cancer surgery: A retrospective observational study. Sci Rep. 7:140202017. View Article : Google Scholar : PubMed/NCBI

12 

Zheng X, Wang Y, Dong L, Zhao S, Wang L, Chen H, Xu Y and Wang G: Effects of propofol-based total intravenous anesthesia on gastric cancer: A retrospective study. OncoTargets Ther. 11:1141–1148. 2018. View Article : Google Scholar : PubMed/NCBI

13 

Wu ZF, Lee MS, Wong CS, Lu CH, Huang YS, Lin KT, Lou YS, Lin C, Chang YC and Lai HC: Propofol-based Total Intravenous Anesthesia Is Associated with Better Survival Than Desflurane Anesthesia in Colon Cancer Surgery. Anesthesiology. 129:932–941. 2018. View Article : Google Scholar : PubMed/NCBI

14 

Lai HC, Lee MS, Lin C, Lin KT, Huang YH, Wong CS, Chan SM and Wu ZF: Propofol-based total intravenous anaesthesia is associated with better survival than desflurane anaesthesia in hepatectomy for hepatocellular carcinoma: A retrospective cohort study. Br J Anaesth. 123:151–160. 2019. View Article : Google Scholar : PubMed/NCBI

15 

Lai HC, Lee MS, Lin KT, Chan SM, Chen JY, Lin YT and Wu ZF: Propofol-based total intravenous anesthesia is associated with better survival than desflurane anesthesia in intrahepatic cholangiocarcinoma surgery. Medicine (Baltimore). 98:e184722019. View Article : Google Scholar : PubMed/NCBI

16 

Guerrero Orriach JL, Raigon Ponferrada A, Malo Manso A, Herrera Imbroda B, Escalona Belmonte JJ, Ramirez Aliaga M, Ramirez Fernandez A, Diaz Crespo J, Soriano Perez AM, Fontaneda Heredia A, et al: Anesthesia in Combination with Propofol Increases Disease-Free Survival in Bladder Cancer Patients Who Undergo Radical Tumor Cystectomy as Compared to Inhalational Anesthetics and Opiate-Based Analgesia. Oncology. 98:161–167. 2020. View Article : Google Scholar : PubMed/NCBI

17 

Nazemi M and Rainero E: Cross-Talk Between the Tumor Microenvironment, Extracellular Matrix, and Cell Metabolism in Cancer. Front Oncol. 10:2392020. View Article : Google Scholar : PubMed/NCBI

18 

Wilson TR, Fridlyand J, Yan Y, Penuel E, Burton L, Chan E, Peng J, Lin E, Wang Y, Sosman J, et al: Widespread potential for growth-factor-driven resistance to anticancer kinase inhibitors. Nature. 487:505–509. 2012. View Article : Google Scholar : PubMed/NCBI

19 

Nisar S, Yousuf P, Masoodi T, Wani NA, Hashem S, Singh M, Sageena G, Mishra D, Kumar R, Haris M, et al: Chemokine-Cytokine Networks in the Head and Neck Tumor Microenvironment. Int J Mol Sci. 22:45842021. View Article : Google Scholar : PubMed/NCBI

20 

Mughees M, Sengupta A, Khowal S and Wajid S: Mechanism of tumour microenvironment in the progression and development of oral cancer. Mol Biol Rep. 48:1773–1786. 2021. View Article : Google Scholar : PubMed/NCBI

21 

Sen Y, Xiyang H and Yu H: Effect of thoracic paraspinal block-propofol intravenous general anesthesia on VEGF and TGF-β in patients receiving radical resection of lung cancer. Medicine (Baltimore). 98:e180882019. View Article : Google Scholar : PubMed/NCBI

22 

Chen Z, Dodig-Crnković T, Schwenk JM and Tao SC: Current applications of antibody microarrays. Clin Proteomics. 15:72018. View Article : Google Scholar : PubMed/NCBI

23 

Tang Z, Li C, Kang B, Gao G, Li C and Zhang Z: GEPIA: A web server for cancer and normal gene expression profiling and interactive analyses. Nucleic Acids Res. 45W:W98–W102. 2017. View Article : Google Scholar : PubMed/NCBI

24 

Livak KJ and Schmittgen TD: Analysis of relative gene expression data using real-time quantitative PCR and the 2(−Delta Delta C(T)) Method. Methods. 25:402–408. 2001. View Article : Google Scholar : PubMed/NCBI

25 

Boulares AH, Yakovlev AG, Ivanova V, Stoica BA, Wang G, Iyer S and Smulson M: Role of poly(ADP-ribose) polymerase (PARP) cleavage in apoptosis. Caspase 3-resistant PARP mutant increases rates of apoptosis in transfected cells. J Biol Chem. 274:22932–22940. 1999. View Article : Google Scholar : PubMed/NCBI

26 

Castells M, Thibault B, Delord JP and Couderc B: Implication of tumor microenvironment in chemoresistance: Tumor-associated stromal cells protect tumor cells from cell death. Int J Mol Sci. 13:9545–9571. 2012. View Article : Google Scholar : PubMed/NCBI

27 

Berasain C and Avila MA: Amphiregulin. Semin Cell Dev Biol. 28:31–41. 2014. View Article : Google Scholar : PubMed/NCBI

28 

Bateman BT and Kesselheim AS: Propofol as a transformative drug in anesthesia: Insights from key early investigators. Drug Discov Today. 20:1012–1017. 2015. View Article : Google Scholar : PubMed/NCBI

29 

Busser B, Sancey L, Brambilla E, Coll JL and Hurbin A: The multiple roles of amphiregulin in human cancer. Biochim Biophys Acta. 1816:119–131. 2011.PubMed/NCBI

30 

Gao J, Ulekleiv CH and Halstensen TS: Epidermal growth factor (EGF) receptor-ligand based molecular staging predicts prognosis in head and neck squamous cell carcinoma partly due to deregulated EGF- induced amphiregulin expression. J Exp Clin Cancer Res. 35:1512016. View Article : Google Scholar : PubMed/NCBI

31 

Hsieh MJ, Chen YH, Lee IN, Huang C, Ku YJ and Chen JC: Secreted amphiregulin promotes vincristine resistance in oral squamous cell carcinoma. Int J Oncol. 55:949–959. 2019.PubMed/NCBI

32 

Bourova-Flin E, Derakhshan S, Goudarzi A, Wang T, Vitte AL, Chuffart F, Khochbin S, Rousseaux S and Aminishakib P: The combined detection of Amphiregulin, Cyclin A1 and DDX20/Gemin3 expression predicts aggressive forms of oral squamous cell carcinoma. Br J Cancer. 125:1122–1134. 2021. View Article : Google Scholar : PubMed/NCBI

33 

Bossi P, Resteghini C, Paielli N, Licitra L, Pilotti S and Perrone F: Prognostic and predictive value of EGFR in head and neck squamous cell carcinoma. Oncotarget. 7:74362–74379. 2016. View Article : Google Scholar : PubMed/NCBI

34 

Sarkis SA, Abdullah BH, Abdul Majeed BA and Talabani NG: Immunohistochemical expression of epidermal growth factor receptor (EGFR) in oral squamous cell carcinoma in relation to proliferation, apoptosis, angiogenesis and lymphangiogenesis. Head Neck Oncol. 2:132010. View Article : Google Scholar : PubMed/NCBI

35 

Son HK, Kim D, Lim Y, Kim J and Park I: A novel TGF-β receptor II mutation (I227T/N236D) promotes aggressive phenotype of oral squamous cell carcinoma via enhanced EGFR signaling. BMC Cancer. 20:11632020. View Article : Google Scholar : PubMed/NCBI

36 

Tsou HH, Tsai HC, Chu CT, Cheng HW, Liu CJ, Lee CH, Liu TY and Wang HT: Cigarette Smoke Containing Acrolein Upregulates EGFR Signaling Contributing to Oral Tumorigenesis In Vitro and In Vivo. Cancers (Basel). 13:35442021. View Article : Google Scholar : PubMed/NCBI

37 

Yang W, Cai J, Zabkiewicz C, Zhang H, Ruge F and Jiang WG: The Effects of Anesthetics on Recurrence and Metastasis of Cancer, and Clinical Implications. World J Oncol. 8:63–70. 2017. View Article : Google Scholar : PubMed/NCBI

38 

Cassinello F, Prieto I, del Olmo M, Rivas S and Strichartz GR: Cancer surgery: How may anesthesia influence outcome? J Clin Anesth. 27:262–272. 2015. View Article : Google Scholar : PubMed/NCBI

39 

Snyder GL and Greenberg S: Effect of anaesthetic technique and other perioperative factors on cancer recurrence. Br J Anaesth. 105:106–115. 2010. View Article : Google Scholar : PubMed/NCBI

40 

Plein LM and Rittner HL: Opioids and the immune system - friend or foe. Br J Pharmacol. 175:2717–2725. 2018. View Article : Google Scholar : PubMed/NCBI

41 

Ye Z, Jingzhong L, Yangbo L, Lei C and Jiandong Y: Propofol inhibits proliferation and invasion of osteosarcoma cells by regulation of microRNA-143 expression. Oncol Res. 21:201–207. 2013. View Article : Google Scholar : PubMed/NCBI

42 

Zhang J, Wu GQ, Zhang Y, Feng ZY and Zhu SM: Propofol induces apoptosis of hepatocellular carcinoma cells by upregulation of microRNA-199a expression. Cell Biol Int. 37:227–232. 2013. View Article : Google Scholar : PubMed/NCBI

43 

Cui WY, Liu Y, Zhu YQ, Song T and Wang QS: Propofol induces endoplasmic reticulum (ER) stress and apoptosis in lung cancer cell H460. Tumour Biol. 35:5213–5217. 2014. View Article : Google Scholar : PubMed/NCBI

44 

Su Z, Hou XK and Wen QP: Propofol induces apoptosis of epithelial ovarian cancer cells by upregulation of microRNA let-7i expression. Eur J Gynaecol Oncol. 35:688–691. 2014.PubMed/NCBI

45 

Zhang D, Zhou XH, Zhang J, Zhou YX, Ying J, Wu GQ and Qian JH: Propofol promotes cell apoptosis via inhibiting HOTAIR mediated mTOR pathway in cervical cancer. Biochem Biophys Res Commun. 468:561–567. 2015. View Article : Google Scholar : PubMed/NCBI

46 

Xu J, Xu W and Zhu J: Propofol suppresses proliferation and invasion of glioma cells by upregulating microRNA-218 expression. Mol Med Rep. 12:4815–4820. 2015. View Article : Google Scholar : PubMed/NCBI

47 

Peng Z and Zhang Y: Propofol inhibits proliferation and accelerates apoptosis of human gastric cancer cells by regulation of microRNA-451 and MMP-2 expression. Genet Mol Res. 15:gmr70782016. View Article : Google Scholar

48 

Yu B, Gao W, Zhou H, Miao X, Chang Y, Wang L, Xu M and Ni G: Propofol induces apoptosis of breast cancer cells by downregulation of miR-24 signal pathway. Cancer Biomark. 21:513–519. 2018. View Article : Google Scholar : PubMed/NCBI

49 

Li Y, Dong W, Yang H and Xiao G: Propofol suppresses proliferation and metastasis of colorectal cancer cells by regulating miR-124-3p.1/AKT3. Biotechnol Lett. 42:493–504. 2020. View Article : Google Scholar : PubMed/NCBI

50 

Gao C, Ren C, Liu Z, Zhang L, Tang R and Li X: GAS5, a FoxO1-actived long noncoding RNA, promotes propofol-induced oral squamous cell carcinoma apoptosis by regulating the miR-1297-GSK3β axis. Artif Cells Nanomed Biotechnol. 47:3985–3993. 2019. View Article : Google Scholar : PubMed/NCBI

51 

Wigmore TJ, Mohammed K and Jhanji S: Long-term Survival for Patients Undergoing Volatile versus IV Anesthesia for Cancer Surgery: A Retrospective Analysis. Anesthesiology. 124:69–79. 2016. View Article : Google Scholar : PubMed/NCBI

52 

Lai HC, Lee MS, Lin KT, Huang YH, Chen JY, Lin YT, Hung KC and Wu ZF: Propofol-based total intravenous anesthesia is associated with better survival than desflurane anesthesia in robot-assisted radical prostatectomy. PLoS One. 15:e02302902020. View Article : Google Scholar : PubMed/NCBI

53 

Wu T and Dai Y: Tumor microenvironment and therapeutic response. Cancer Lett. 387:61–68. 2017. View Article : Google Scholar : PubMed/NCBI

54 

Zhang Y, Ho SH, Li B, Nie G and Li S: Modulating the tumor microenvironment with new therapeutic nanoparticles: A promising paradigm for tumor treatment. Med Res Rev. 40:1084–1102. 2020. View Article : Google Scholar : PubMed/NCBI

55 

Chen RM, Chen TG, Chen TL, Lin LL, Chang CC, Chang HC and Wu CH: Anti-inflammatory and antioxidative effects of propofol on lipopolysaccharide-activated macrophages. Ann N Y Acad Sci. 1042:262–271. 2005. View Article : Google Scholar : PubMed/NCBI

56 

Gao Y, Yu X, Zhang F and Dai J: Propofol inhibits pancreatic cancer progress under hypoxia via ADAM8. J Hepatobiliary Pancreat Sci. 26:219–226. 2019. View Article : Google Scholar : PubMed/NCBI

57 

Yu X, Shi J, Wang X and Zhang F: Propofol affects the growth and metastasis of pancreatic cancer via ADAM8. Pharmacol Rep. 72:418–426. 2020. View Article : Google Scholar : PubMed/NCBI

58 

Murphy G: The ADAMs: Signalling scissors in the tumour microenvironment. Nat Rev Cancer. 8:929–941. 2008. View Article : Google Scholar : PubMed/NCBI

59 

Yan T, Zhang GH, Wang BN, Sun L and Zheng H: Effects of propofol/remifentanil-based total intravenous anesthesia versus sevoflurane-based inhalational anesthesia on the release of VEGF-C and TGF-β and prognosis after breast cancer surgery: A prospective, randomized and controlled study. BMC Anesthesiol. 18:1312018. View Article : Google Scholar : PubMed/NCBI

60 

Shigetomi S, Imanishi Y, Shibata K, Sakai N, Sakamoto K, Fujii R, Habu N, Otsuka K, Sato Y, Watanabe Y, et al: VEGF-C/Flt-4 axis in tumor cells contributes to the progression of oral squamous cell carcinoma via upregulating VEGF-C itself and contactin-1 in an autocrine manner. Am J Cancer Res. 8:2046–2063. 2018.PubMed/NCBI

61 

Zhang J, Shan WF, Jin TT, Wu GQ, Xiong XX, Jin HY and Zhu SM: Propofol exerts anti-hepatocellular carcinoma by microvesicle-mediated transfer of miR-142-3p from macrophage to cancer cells. J Transl Med. 12:2792014. View Article : Google Scholar : PubMed/NCBI

62 

Buschmann D, Brandes F, Lindemann A, Maerte M, Ganschow P, Chouker A, Schelling G, Pfaffl MW and Reithmair M: Propofol and Sevoflurane Differentially Impact MicroRNAs in Circulating Extracellular Vesicles during Colorectal Cancer Resection: A Pilot Study. Anesthesiology. 132:107–120. 2020. View Article : Google Scholar : PubMed/NCBI

63 

Wang J, Cheng CS, Lu Y, Ding X, Zhu M, Miao C and Chen J: Novel Findings of Anti-cancer Property of Propofol. Anticancer Agents Med Chem. 18:156–165. 2018. View Article : Google Scholar : PubMed/NCBI

64 

Cramer JD, Burtness B, Le QT and Ferris RL: The changing therapeutic landscape of head and neck cancer. Nat Rev Clin Oncol. 16:669–683. 2019. View Article : Google Scholar : PubMed/NCBI

Related Articles

  • Abstract
  • View
  • Download
  • Twitter
Copy and paste a formatted citation
Spandidos Publications style
Yang K, Che P, Hsieh M, Lee I, Wu Y, Chen M and Chen J: Propofol induces apoptosis and ameliorates 5‑fluorouracil resistance in OSCC cells by reducing the expression and secretion of amphiregulin. Mol Med Rep 25: 36, 2022.
APA
Yang, K., Che, P., Hsieh, M., Lee, I., Wu, Y., Chen, M., & Chen, J. (2022). Propofol induces apoptosis and ameliorates 5‑fluorouracil resistance in OSCC cells by reducing the expression and secretion of amphiregulin. Molecular Medicine Reports, 25, 36. https://doi.org/10.3892/mmr.2021.12552
MLA
Yang, K., Che, P., Hsieh, M., Lee, I., Wu, Y., Chen, M., Chen, J."Propofol induces apoptosis and ameliorates 5‑fluorouracil resistance in OSCC cells by reducing the expression and secretion of amphiregulin". Molecular Medicine Reports 25.1 (2022): 36.
Chicago
Yang, K., Che, P., Hsieh, M., Lee, I., Wu, Y., Chen, M., Chen, J."Propofol induces apoptosis and ameliorates 5‑fluorouracil resistance in OSCC cells by reducing the expression and secretion of amphiregulin". Molecular Medicine Reports 25, no. 1 (2022): 36. https://doi.org/10.3892/mmr.2021.12552
Copy and paste a formatted citation
x
Spandidos Publications style
Yang K, Che P, Hsieh M, Lee I, Wu Y, Chen M and Chen J: Propofol induces apoptosis and ameliorates 5‑fluorouracil resistance in OSCC cells by reducing the expression and secretion of amphiregulin. Mol Med Rep 25: 36, 2022.
APA
Yang, K., Che, P., Hsieh, M., Lee, I., Wu, Y., Chen, M., & Chen, J. (2022). Propofol induces apoptosis and ameliorates 5‑fluorouracil resistance in OSCC cells by reducing the expression and secretion of amphiregulin. Molecular Medicine Reports, 25, 36. https://doi.org/10.3892/mmr.2021.12552
MLA
Yang, K., Che, P., Hsieh, M., Lee, I., Wu, Y., Chen, M., Chen, J."Propofol induces apoptosis and ameliorates 5‑fluorouracil resistance in OSCC cells by reducing the expression and secretion of amphiregulin". Molecular Medicine Reports 25.1 (2022): 36.
Chicago
Yang, K., Che, P., Hsieh, M., Lee, I., Wu, Y., Chen, M., Chen, J."Propofol induces apoptosis and ameliorates 5‑fluorouracil resistance in OSCC cells by reducing the expression and secretion of amphiregulin". Molecular Medicine Reports 25, no. 1 (2022): 36. https://doi.org/10.3892/mmr.2021.12552
Follow us
  • Twitter
  • LinkedIn
  • Facebook
About
  • Spandidos Publications
  • Careers
  • Cookie Policy
  • Privacy Policy
How can we help?
  • Help
  • Live Chat
  • Contact
  • Email to our Support Team