Spandidos Publications Logo
  • About
    • About Spandidos
    • Aims and Scopes
    • Abstracting and Indexing
    • Editorial Policies
    • Reprints and Permissions
    • Job Opportunities
    • Terms and Conditions
    • Contact
  • Journals
    • All Journals
    • Oncology Letters
      • Oncology Letters
      • Information for Authors
      • Editorial Policies
      • Editorial Board
      • Aims and Scope
      • Abstracting and Indexing
      • Bibliographic Information
      • Archive
    • International Journal of Oncology
      • International Journal of Oncology
      • Information for Authors
      • Editorial Policies
      • Editorial Board
      • Aims and Scope
      • Abstracting and Indexing
      • Bibliographic Information
      • Archive
    • Molecular and Clinical Oncology
      • Molecular and Clinical Oncology
      • Information for Authors
      • Editorial Policies
      • Editorial Board
      • Aims and Scope
      • Abstracting and Indexing
      • Bibliographic Information
      • Archive
    • Experimental and Therapeutic Medicine
      • Experimental and Therapeutic Medicine
      • Information for Authors
      • Editorial Policies
      • Editorial Board
      • Aims and Scope
      • Abstracting and Indexing
      • Bibliographic Information
      • Archive
    • International Journal of Molecular Medicine
      • International Journal of Molecular Medicine
      • Information for Authors
      • Editorial Policies
      • Editorial Board
      • Aims and Scope
      • Abstracting and Indexing
      • Bibliographic Information
      • Archive
    • Biomedical Reports
      • Biomedical Reports
      • Information for Authors
      • Editorial Policies
      • Editorial Board
      • Aims and Scope
      • Abstracting and Indexing
      • Bibliographic Information
      • Archive
    • Oncology Reports
      • Oncology Reports
      • Information for Authors
      • Editorial Policies
      • Editorial Board
      • Aims and Scope
      • Abstracting and Indexing
      • Bibliographic Information
      • Archive
    • Molecular Medicine Reports
      • Molecular Medicine Reports
      • Information for Authors
      • Editorial Policies
      • Editorial Board
      • Aims and Scope
      • Abstracting and Indexing
      • Bibliographic Information
      • Archive
    • World Academy of Sciences Journal
      • World Academy of Sciences Journal
      • Information for Authors
      • Editorial Policies
      • Editorial Board
      • Aims and Scope
      • Abstracting and Indexing
      • Bibliographic Information
      • Archive
    • International Journal of Functional Nutrition
      • International Journal of Functional Nutrition
      • Information for Authors
      • Editorial Policies
      • Editorial Board
      • Aims and Scope
      • Abstracting and Indexing
      • Bibliographic Information
      • Archive
    • International Journal of Epigenetics
      • International Journal of Epigenetics
      • Information for Authors
      • Editorial Policies
      • Editorial Board
      • Aims and Scope
      • Abstracting and Indexing
      • Bibliographic Information
      • Archive
    • Medicine International
      • Medicine International
      • Information for Authors
      • Editorial Policies
      • Editorial Board
      • Aims and Scope
      • Abstracting and Indexing
      • Bibliographic Information
      • Archive
  • Articles
  • Information
    • Information for Authors
    • Information for Reviewers
    • Information for Librarians
    • Information for Advertisers
    • Conferences
  • Language Editing
Spandidos Publications Logo
  • About
    • About Spandidos
    • Aims and Scopes
    • Abstracting and Indexing
    • Editorial Policies
    • Reprints and Permissions
    • Job Opportunities
    • Terms and Conditions
    • Contact
  • Journals
    • All Journals
    • Biomedical Reports
      • Information for Authors
      • Editorial Policies
      • Editorial Board
      • Aims and Scope
      • Abstracting and Indexing
      • Bibliographic Information
      • Archive
    • Experimental and Therapeutic Medicine
      • Information for Authors
      • Editorial Policies
      • Editorial Board
      • Aims and Scope
      • Abstracting and Indexing
      • Bibliographic Information
      • Archive
    • International Journal of Epigenetics
      • Information for Authors
      • Editorial Policies
      • Editorial Board
      • Aims and Scope
      • Abstracting and Indexing
      • Bibliographic Information
      • Archive
    • International Journal of Functional Nutrition
      • Information for Authors
      • Editorial Policies
      • Editorial Board
      • Aims and Scope
      • Abstracting and Indexing
      • Bibliographic Information
      • Archive
    • International Journal of Molecular Medicine
      • Information for Authors
      • Editorial Policies
      • Editorial Board
      • Aims and Scope
      • Abstracting and Indexing
      • Bibliographic Information
      • Archive
    • International Journal of Oncology
      • Information for Authors
      • Editorial Policies
      • Editorial Board
      • Aims and Scope
      • Abstracting and Indexing
      • Bibliographic Information
      • Archive
    • Medicine International
      • Information for Authors
      • Editorial Policies
      • Editorial Board
      • Aims and Scope
      • Abstracting and Indexing
      • Bibliographic Information
      • Archive
    • Molecular and Clinical Oncology
      • Information for Authors
      • Editorial Policies
      • Editorial Board
      • Aims and Scope
      • Abstracting and Indexing
      • Bibliographic Information
      • Archive
    • Molecular Medicine Reports
      • Information for Authors
      • Editorial Policies
      • Editorial Board
      • Aims and Scope
      • Abstracting and Indexing
      • Bibliographic Information
      • Archive
    • Oncology Letters
      • Information for Authors
      • Editorial Policies
      • Editorial Board
      • Aims and Scope
      • Abstracting and Indexing
      • Bibliographic Information
      • Archive
    • Oncology Reports
      • Information for Authors
      • Editorial Policies
      • Editorial Board
      • Aims and Scope
      • Abstracting and Indexing
      • Bibliographic Information
      • Archive
    • World Academy of Sciences Journal
      • Information for Authors
      • Editorial Policies
      • Editorial Board
      • Aims and Scope
      • Abstracting and Indexing
      • Bibliographic Information
      • Archive
  • Articles
  • Information
    • For Authors
    • For Reviewers
    • For Librarians
    • For Advertisers
    • Conferences
  • Language Editing
Login Register Submit
  • This site uses cookies
  • You can change your cookie settings at any time by following the instructions in our Cookie Policy. To find out more, you may read our Privacy Policy.

    I agree
Search articles by DOI, keyword, author or affiliation
Search
Advanced Search
presentation
International Journal of Molecular Medicine
Join Editorial Board Propose a Special Issue
Print ISSN: 1107-3756 Online ISSN: 1791-244X
Journal Cover
August-2014 Volume 34 Issue 2

Full Size Image

Sign up for eToc alerts
Recommend to Library

Journals

International Journal of Molecular Medicine

International Journal of Molecular Medicine

International Journal of Molecular Medicine is an international journal devoted to molecular mechanisms of human disease.

International Journal of Oncology

International Journal of Oncology

International Journal of Oncology is an international journal devoted to oncology research and cancer treatment.

Molecular Medicine Reports

Molecular Medicine Reports

Covers molecular medicine topics such as pharmacology, pathology, genetics, neuroscience, infectious diseases, molecular cardiology, and molecular surgery.

Oncology Reports

Oncology Reports

Oncology Reports is an international journal devoted to fundamental and applied research in Oncology.

Experimental and Therapeutic Medicine

Experimental and Therapeutic Medicine

Experimental and Therapeutic Medicine is an international journal devoted to laboratory and clinical medicine.

Oncology Letters

Oncology Letters

Oncology Letters is an international journal devoted to Experimental and Clinical Oncology.

Biomedical Reports

Biomedical Reports

Explores a wide range of biological and medical fields, including pharmacology, genetics, microbiology, neuroscience, and molecular cardiology.

Molecular and Clinical Oncology

Molecular and Clinical Oncology

International journal addressing all aspects of oncology research, from tumorigenesis and oncogenes to chemotherapy and metastasis.

World Academy of Sciences Journal

World Academy of Sciences Journal

Multidisciplinary open-access journal spanning biochemistry, genetics, neuroscience, environmental health, and synthetic biology.

International Journal of Functional Nutrition

International Journal of Functional Nutrition

Open-access journal combining biochemistry, pharmacology, immunology, and genetics to advance health through functional nutrition.

International Journal of Epigenetics

International Journal of Epigenetics

Publishes open-access research on using epigenetics to advance understanding and treatment of human disease.

Medicine International

Medicine International

An International Open Access Journal Devoted to General Medicine.

Journal Cover
August-2014 Volume 34 Issue 2

Full Size Image

Sign up for eToc alerts
Recommend to Library

  • Article
  • Citations
    • Cite This Article
    • Download Citation
    • Create Citation Alert
    • Remove Citation Alert
    • Cited By
  • Similar Articles
    • Related Articles (in Spandidos Publications)
    • Similar Articles (Google Scholar)
    • Similar Articles (PubMed)
  • Download PDF
  • Download XML
  • View XML
Article

Brain death induces the alteration of liver protein expression profiles in rabbits

  • Authors:
    • Bing Du
    • Ling Li
    • Zhibiao Zhong
    • Xiaoli Fan
    • Bingbing Qiao
    • Chongxiang He
    • Zhen Fu
    • Yanfeng Wang
    • Qifa Ye
  • View Affiliations / Copyright

    Affiliations: Zhongnan Hospital of Wuhan University, Institute of Hepatobiliary Diseases of Wuhan University, Transplant Center of Wuhan University, Hubei Key Laboratory of Medical Technology on Transplantation, Wuhan, Hubei 430071, P.R. China
  • Pages: 578-584
    |
    Published online on: June 16, 2014
       https://doi.org/10.3892/ijmm.2014.1806
  • Expand metrics +
Metrics: Total Views: 0 (Spandidos Publications: | PMC Statistics: )
Metrics: Total PDF Downloads: 0 (Spandidos Publications: | PMC Statistics: )
Cited By (CrossRef): 0 citations Loading Articles...

This article is mentioned in:


Abstract

At present, there is no accurate method for evaluating the quality of liver transplant from a brain-dead donor. Proteomics are used to investigate the mechanisms involved in brain death‑induced liver injury and to identify sensitive biomarkers. In the present study, age‑ and gender‑matched rabbits were randomly divided into the brain death and sham groups. The sham served as the control. A brain‑death model was established using an intracranial progressive pressurized method. The differentially expressed proteins extracted from the liver tissues of rabbits that were brain‑dead for 6 h in the two groups were determined by two‑dimensional gel electrophoresis and matrix‑assisted laser desorption ionization time of flight mass spectrometry. Although there was no obvious functional and morphological difference in 2, 4 and 6 h after brain death, results of the proteomics analysis revealed 973±34 and 987±38 protein spots in the control and brain death groups, respectively. Ten proteins exhibited a ≥2‑fold alteration. The downregulated proteins were: aldehyde dehydrogenase, runt‑related transcription factor 1 (RUNX1), inorganic pyrophosphatase, glutamate‑cysteine ligase regulatory subunit and microsomal cytochrome B5. By contrast, the expression of dihydropyrimidinase-related protein 4, peroxiredoxin‑6, 3‑phosphoinositide‑dependent protein kinase‑1, 3-mercaptopyruvate and alcohol dehydrogenase were clearly upregulated. Immunohistochemistry and western blot analysis results revealed that the expression of RUNX1 was gradually increased in a time‑dependent manner in 2, 4, and 6 h after brain death. In conclusion, alteration of the liver protein expression profile induced by brain death indicated the occurrence of complex pathological changes even if no functional or morphological difference was identified. Thus, RUNX1 may be a sensitive predict factor for evaluating the quality of brain death donated liver.

Introduction

Brain death refers to the irreversible loss of all functions of the brain, including the brainstem. Legal recognition of donor sources, as well as the expansion of origin of the donor source are crucial factors that remain to be addressed (1,2). Since the establishment of the first brain-death donor model in the late 1960s and early 1970s, solid organ transplantation from brain-dead donors has become common in western countries (3). In China, the rapid progress in organ transplant legislation and establishment of voluntary donation, donation after brain death (DBD) or cardiac death (DCD) has gradually replaced deceased donors and is due to become the main source of donors (4–6). However, the quality of brain-dead donors was comparatively worse than that of deceased donors. Subsequently, recent or long-term transplant efficacy was not successful (7–9).

Numerous studies have reported that the changes of hemodynamics and metabolic parameters (10,11), hormonal changes and the endocrines (12–14), the consumption of coagulation factors (15,16), the release of inflammatory cytokines and the change of immunological states (10,17–20) may be responsible for the injury of brain death-donated organs. However, the detailed mechanism involved remains to be clarified. Additionally, accurate methods for identifying the quality of brain death donor organs remain to be identified.

Protein is considered the ultimate performer of various biological functions and proteomics is the classical method used for the screening of specific biological markers (21,22). Using two-dimensional gel electrophoresis and matrix-assisted laser desorption ionization time of flight mass spectrometry, the purpose of this study was to detect alterations in the liver protein expression profile between the brain death and control groups at different time-points after brain death, and to predict sensitivity factors to explain the detailed mechanism involved. Additionally, we aimed to establish a sensitivity method to evaluate the quality of brain death donors for transplantation.

Materials and methods

Animals

Twelve-week-old male rabbits (Wuhan Wanqianjiahe Experimental Animal Breeding Center) were randomly divided in the brain death and sham (control) groups. Each group was subdivided into four subgroups according to different time-points (2, 4, 6 and 8 h) after brain death (n=5). All the rabbits were kept in the room with water and food ad libitum in a room with controlled temperature (22±1°C), humidity (50–70%) and 12-h light/dark cycle in the Experimental Animal Center of Wuhan University. Animal experiments were conducted under Institutional guidelines and approved by the Ethics Committee for Animal Care and Use of the Wuhan University according to the animal protocol.

Establishment of the model of rabbit brain death

A brain death model was established using an intracranial progressive pressurized method, similar to that of Pratschke et al (23). After being anesthetized with pentobarbital sodium at a dose of 40 mg/kg, the rabbits were placed on the operating table in a supine position. Femoral artery and vein cannulation, xiphoid separation and tracheal intubation were performed, as well as burr hole and catheter placement. Vital signs of the rabbits including electrocardiogram, blood pressure, respiratory and electroencephalogram were monitored using a biological functional system, rodent ventilator and intelligent temperature control instrument (Thai Union Technology, Co., Ltd., Chengdu, China). Intracranial pressure was increased as required until the occurrence of brain death.

Liver function measuring

Blood samples were collected from each rabbit at 2, 4, 6 and 8 h after brain death. Serum glutamic pyruvic transaminase (ALT) and glutamic oxaloacetic transaminase (AST) levels reflecting the liver functions were measured by automatic biochemical analyzer (Hitachi, Tokyo, Japan).

Histomorphometrical evaluation

At 2, 4, 6 and 8 h after brain death, the liver tissues were isolated and fixed in 10% buffered formaldehyde for >24 h and then embedded in paraffin. Serial sections (4 μm) were stained with hematoxylin and eosin for cell morphometry. Three sections per animal and five fields per section were scanned and computerized with a digital image analyzer [Medical Image Analysis System (MIAS)] (Beijing University of Aeronautics and Astronautics).

Protein extraction and 2-DE proteomics profiling

Following the manufacturer’s instructions, the ReadyPrep Sequential Extraction kit (Bio-Rad, Hercules, CA, USA) was used to extract proteins from the liver tissues. The tissues were then washed with the PlusOne 2-D Clean-Up kit (GE Healthcare, Piscataway, NJ, USA) and dissolved with sample buffer. Proteins (150 μg) from the control group and the 6-h after brain death group were mixed with rehydration buffer. Using an Ettan IPGphor Electrophoresis System (GE Healthcare), the mixture was isoelectrically focused at 500 V for 1 h; 1,000 V for 1 h; 3,000 V for 1 h and 8,000 V for 9.5 h subsequent to rehydration for 12 h at 30 V on Immobiline IPG DryStrips (GE Healthcare). IPG strips were applied for 12% sodium dodecyl sulfate polyacrylamide gel electrophoresis (SDS-PAGE) using a PROTEAN® II xi Cell system (Bio-Rad) following equilibration for 2×15 min in an equilibration buffer. Each sample was measured in triplicate.

Gel image acquisition and analysis

The Coomassie Brilliant Blue R-350 (Amersham Biosciences, Amersham, UK) and PDQuest 2D analysis software (Bio-Rad) were used to stain 2-DE gel images and detect protein spots, respectively. Sensitivity parameters were simultaneously reproduced for each gel image and spot detection and matching were manually revised in the software. Based on the three independent pools of biological material, reproducible protein patterns were measured by the presence of each individual protein in three replicate gels. The intensity of each protein spot was normalized to the total density in the gel.

Protein identification

Following excision from the gel, the protein spots were subjected to destaining, washing and in-gel digestion with protease trypsin at 37°C overnight. Subsequently, peptides were extracted from the gel and dried by centrifugal lyophilization. The peptide mixtures were redissolved in 0.5% TFA and analyzed using a 4700 Proteomics Analyzer (Applied Biosystems, Inc., Foster City, CA, USA). The Mascot software (Matrix Science, London, UK) was used for protein identification and the mass spectra were searched in the Swiss-Prot protein database. Protein scores >56 were considered as significant. If one spot matched >1 protein member, the one with the highest score was taken into consideration.

Re-identification of typical protein

In order to further identify these different proteins, randomly runt-related transcription factor 1 (RUNX1) was selected and the difference with immunohistochemistry and western blot analysis in the brain death and control groups was re-identified.

The liver tissues obtained from the control and experimental groups at 2, 4, 6 and 8 h after brain death were deparaffinized and the endogenous peroxidase was blocked with 3% H2O2 for 10 min. The tissues were then incubated with primary polyclonal rabbit antibody against RUNX1 (1:500)and β-actin (1:200; Boster Biological Engineering, Co., Ltd., Wuhan, China) for 1 h at 37°C, followed by biotin-labeled goat anti-rabbit immunoglobulin (Ig) G for 20 min. After sequential incubation with Streptavidin-Biotin complex (SABC) (Santa Cruz Biotechnology, Inc., Santa Cruz, CA, USA) and DAB as substrate, the samples were counterstained with hematoxylin. Five random fields of each stained section were visualized and analyzed using morphometric software (MIAS, Beijing University of Aeronautics and Astronautics) by an investigator who was blinded to the animals’ treatment status.

The proteins extracted from the liver tissues of the control and brain death groups at 2, 4, 6 and 8 h were prepared by homogenizing in RIPA buffer containing protease inhibitors (Boston BioProducts, Inc., MA, USA) followed by centrifugation at 10,000 × g for 10 min at 4°C. Samples were stored at −80°C until use. Protein concentrations of the lysates were determined by the BCA Assay kit (Pierce Biotechnology, Inc., Rockford, IL, USA). Proteins were then separated using 12.5% SDS polyacrylamide gel electrophoresis and transferred to a PVDF membrane (0.2 μm; Millipore, Bedford, MA, USA). The membrane was then blocked with 5% non-fat dry milk overnight and probed with primary rabbit polyclonal antibody against RUNX1 (1:500, Boster Biological Engineering, Co., Ltd.). The proteins were then detected on the blot using infrared-labeled secondary antibodies visualized in 800 nm fluorescence channels. The blot was developed and quantified using the Odyssey Infrared Imaging System (LI-COR Biosciences, Lincoln, NE, USA) following the manufacturer’s instructions.

Statistical analysis

Data were expressed as the mean ± standard deviation (SD). Calculations were performed using SPSS 18.0 software. One-way ANOVA was used to compare the differences between two groups. The intergroup differences were compared with repeated measurement design. P<0.05 was considered statistically significant.

Results

Alteration of liver function

Compared with the previous group, there were obvious differences for serum ALT and AST level in each brain death group from initiation to 8 h after rabbits’ brain death. Compared with the control groups, no marked changes in the ALT and AST levels were observed for the 2, 4 and 6 h brain death groups. However, a significant difference between the two groups was observed at 8 h (Fig. 1).

Figure 1

Effects of brain death at different time-points on alteration of serum glutamic pyruvic transaminase (ALT) and glutamic oxaloacetic transaminase (AST) levels (n=5). The serum ALT and AST levels in the control and brain death groups at 2, 4, 6 and 8 h after brain death were measured by automatic biochemical analyzer, separately. (A) and (B) Although a gradual increase for the brain death groups in a time-dependent manner is evident, the serum ALT and AST levels show no significant differences at 2, 4, and 6 h after brain death as compared to the control groups. However, a significant difference is evident between the brain death and control groups at 8 h. *P<0.05 indicates statistical significance compared with previous groups, △P<0.05 indicates statistical significance compared with control groups.

The morphological alteration of liver

No obvious morphological alteration occurred for the liver cells for the control groups at 2, 4 and 6 h. However, some inflammatory cell infiltration occurred for the 8-h groups. For the brain death groups, the liver cells were almost normal in the 2-h group, while mild edema, osteoporosis and compression of the hepatic sinus part was evident in the 4-h group. Liver injuries gradually became exacerbated in a time-dependent manner. In particular, the ballooning degeneration, sinusoidal pressure, no significant hepatic cord structure, abundant periportal lymphocytic infiltration and part of focal necrosis were found in all 8-h brain death group livers (Fig. 2).

Figure 2

Effects of brain death at different time-points on the morphological alteration of liver (n=5). Alterations of morphometry of liver cells stained by hematoxylin and eosin (×100) are shown in Fig. 2. (a–d) No obvious differences were evident in (a–c) at 2, 4, 6 and 8 h for the control group, whereas some inflammatory cell infiltration is evident in (d). (e–h) Morphological alterations in liver at 2, 4, 6 and 8 h for the brain death group. Liver cells were almost normal in the (e) brain death group, while mild edema, osteoporosis and compression of the hepatic sinus part were observed in the liver of the (f) group. Obvious ballooning degeneration, sinusoidal pressure, no significant hepatic cord structure, abundant periportal lymphocytic infiltration and part of focal necrosis were found in (g) and (h) of the livers of the brain death group.

2-DE proteomics profiling of different proteins

Different proteins were obtained by analyzing and comparing the 2-DE-based proteomic profiling of the control and brain death group at 6 h after brain death. PDQuest 2D analysis software was employed to detect 973±34 protein spots in the control group and 987±38 protein spots in the brain death group. Results of the statistical analysis of 2-DE-based proteomic profiling revealed that there were 52 obvious different protein spots between the control and brain death group. Ten of the 52 protein spots differentially expressed in a >2-fold increase or decrease were identified by MS/MS analysis. The positions on the 2-DE-based profiling were annotated in Fig. 3.

Figure 3

Differential protein expression profile analysis of the control and brain death groups using 2-DE gels (n=5). Total protein lysates were separated by isoelectric focusing (IEF) using IPG strips (18 cm, pH 4–7) in the first dimension followed by 12% sodium dodecyl sulfate polyacrylamide gel electrophoresis (SDS-PAGE) in the second dimension. Coomassie-stained gels were analyzed using PDQuest 2D analysis software. (A) Ten of 52 differentially expressed spots were identified by MS/MS analysis (marked with arrows and numbers). (B) Local enlarged 2-DE gel images of 10 spots in brain death liver tissues (b1–10) and controls (a1–10).

Mass spectrum identification and the function classification of different proteins

Following MALDI-TOF/TOF tandem mass spectrometry analysis and the Swiss-Prot protein database search, we found that 5/10 identified different proteins were upregulated while the remaining five were downregulated. The biological associations between the alterations of identified proteins and the progression of brain death-induced liver injury were searched on the www.uniprot.org according to the individual biological and molecular functions. The major biological functions of these 10 proteins were divided into six classifications, including material metabolism (3/10) and redox regulation (2/10), energy metabolism (1/10), cell proliferation and differentiation (3/10), lipid metabolism (1/10) and detoxification (2/10) and neurodevelopment (1/10). Basic information of these proteins and their classifications are listed in detail in Table I.

Table I

Proteins identified by mass spectrometry.

Table I

Proteins identified by mass spectrometry.

Spot no.Protein nameaGene nameAccession no.bpIcSequence coverage (%)Mascot scoreMWc (Da)Subcellular localizationBiological functionProtein expression
1 Dihydropyrimidinase-related protein 4DPYL4Q629516.30225361617CytoplasmNeurodevelopmentUp
2Aldehyde dehydrogenase, mitochondrialALDH2P050916.63178256859Mitochondrial matrixMaterial metabolism, redox regulationDown
3Peroxiredoxin-6PRDX6O352445.644010024860MitochondrionAntioxidant, catabolismUp
4 3-Phosphoinositide-dependent protein kinase-1, isoform CRA_bPDK1O551737.88537219833CytoplasmCell proliferation and differentiationUp
5Runt-related transcription factor 1, isoform CRA_bRUNX1Q630469.08296741392NucleusCell proliferation and differentiationDown
63-Mercaptopyruvate sulfurtransferaseMPSTP975326.13278533443CytoplasmDetoxificationUp
7Inorganic pyrophosphatasePPA1Q151815.26217133206CytoplasmMetabolism, redox regulationDown
8Alcohol dehydrogenase [NADP+]ALDR1P145506.844111136711CytoplasmEnergy metabolismUp
9Glutamate-cysteine ligase regulatory subunitGLCLRP485085.36287030871CytoplasmCell proliferationDown and differentiation
10Microsomal cytochrome B5CYB5P001695.147111010788Endoplasmic reticulum microsomesLipid metabolism, detoxificationDown

a Measured peptide and fragment ion masses were used to search against the Swiss-Prot databases for protein identifications using the Mascot software. Ion scores (based on mass/mass spectrums) were from MALDI-TOF/TOF identification. A Mascot score of >56 was considered as identity (P<0.05).

b Accession numbers were derived from the Swiss-Prot database.

c Theoretical molecular weight (MW) or isoelectric point (pI) from the UniProt database. Up, upregulated indicating protein expression is higher in brain death groups vs. control using the PDQuest analysis. Down, downregulated indicating protein expression is lower in brain death groups vs. control.

Identification and re-identifications of RUNX1 proteins

The predicted molecular mass/isoelectric point (pI) value for RUNX1 was 49 kDa/9.08 which was suitable to the position of the corresponding spot (spot 5) on the 2-DE gel. MS/MS analysis showed that RUNX1 was identified with a Mascot score of 67 and 29% sequence coverage (Fig. 4).

Figure 4

Identification of alteration of runt-related transcription factor 1 (RUNX1) protein expression by MALDI-TOF/TOF tandem mass spectrometry. Acquired spectra were searched against a Mascot search engine based on the Swiss-Prot protein database. MS/MS spectrum of the precursor ion with m/z 2425.2 for peptide 335ILPPCTNASTGAALLNPSLPSQSDVVETEGSHSNSPTNMPPARLEEAVWRPY386 with corresponding peak values was identified as RUNX1. Inset is the Swiss-Prot protein score from the Swiss-Prot database.

Results of the immunohistochemical analysis of RUNX1 revealed that the expression of RUNX1 was decreased in a time-dependent manner in the brain death group. Additionally, the level of RUNX1 for each time-point to some extent decreased compared with the control groups (Fig. 5A). Similarly, results of the western blot analysis revealed a gradual decrease in the brain death group at each time-point compared with control group (Fig. 5B).

Figure 5

Re-identification of altenation of runt-related transcription factor 1 (RUNX1) proteins by immunohistochemistry and western blot analysis. (A) Representative images (×100) of immunohistochemical analysis of (a–d) control samples and (e–h) paired brain death groups. The protein expression of RUNX1 stained in the nucleus in each brain death group is clearly decreased as compared to the control group at 2, 4, 6 and 8 h after brain death. (B) Representative results of western blot analysis of paired brain death groups and control samples with β-actin as an internal control. A significant decrease in a time-dependent manner and compared with the control groups was observed for the brain death groups. *P<0.05 indicates statistical significance compared with the previous groups. △P<0.05 indicates statistical significance compared with the control groups.

Discussion

Previously, the detailed mechanism involving the effect of brain death on the quality of the transplant donor was unclear. In their study, Van Der Hoeven et al (24) used a rat brain death model and found that brain death-induced injury is associated with apoptosis. Avlonitis et al (10) also demonstrated that brain death in rats induced an inflammatory response represented by the elevated levels of IL-6, TNF-α, neutrophil CD11b/CD18, cytokine-induced neutrophil chemoattractant (CINC)-1 and CINC-3. Similar to the establishment of the pig brain death model (25), in the present study, a new rabbit brain death model using an intracranial progressive pressurized method was established using the biological functional system, rodent ventilator and intelligent temperature control instrument. Maintaining of continuous breathing and the monitoring of electroencephalography ensured the model was similar to the state of brain death utilized in the clinic.

Weiss et al (26) reported that significantly upregulated levels of MIP-1α, IL-4, IFN-γ, HO-1, CD3 and CD25 in brain death donor transplantation may be due to the phase of ischemic reperfusion prior to transplantation. In the present study, we have demonstrated that from initiation to 6 h after brain death, there were no obvious functional or morphological alterations (Figs. 1 and 2). Result of the rabbit brain death model also show that efficient information for the quality evaluation of donor livers is lacking. Thus, it appears that in early brain death, the ‘traditional criteria’ may not be sufficiently efficient to identify an appropriate transplant donor.

The proteomics analysis identified 52 different protein spots indicating that complex pathological changes occurred in the state of brain death. Ten significantly different proteins identified were classified into material metabolism and redox regulation, energy metabolism, cell proliferation and differentiation, lipid metabolism and detoxification and neurodevelopment. The appropriate systemic physiologic changes, which are considered to be principally a manifestation of brain death affecting all organs suitable for transplantation, were presumably the result of the ischemia/reperfusion injury (8,10,11,26), followed by oxidative stress (12,27), apoptosis (28,29) and inflammatory response (2,10,20). Evidence suggests that brain death results in the development of a systemic inflammatory response in the donor, which can damage all organs with deleterious impact on their function following transplantation.

RUNX1 is a nucleus gene whose major functions include cell proliferation and differentiation with the activation of PKC-θ and reactive oxygen species (30). Subsequent to the identification of the different RUNX1 protein by immunohistochemistry after proteomics and western blot analysis in the present study, we came to a primary conclusion that in addition to the development of brain death, a gradual decrease of RUNX1 expression was also induced. In other words, the expression of RUNX1 may be an indicator of the degree of brain death-induced liver injury, However, more investigations on the role of RUNX1 in brain death liver injury is required.

Acknowledgements

This investigation was supported by Research Fund for the Doctoral Program of Higher Education (20100141110016); Natural Science Fund of Hubei Province (2012FFA044; 2013CFB258); Science and technology projects of Wuhan city (2013060705010326; 2013060602010247).

References

1 

Zhang SJ and Wang T: The influence of brain death on donor liver and the potential mechanisms of protective intervention. Front Med. 5:8–14. 2011. View Article : Google Scholar : PubMed/NCBI

2 

Watts RP, Thom O and Fraser JF: Inflammatory signalling associated with brain dead organ donation: from brain injury to brain stem death and posttransplant ischaemia reperfusion injury. J Transplant. 2013:5213692013. View Article : Google Scholar

3 

Machado C: The first organ transplant from a brain-dead donor. Neurology. 64:1938–1942. 2005. View Article : Google Scholar : PubMed/NCBI

4 

Huang J, Mao Y and Millis JM: Government policy and organ transplantation in China. Lancet. 372:1937–1938. 2008. View Article : Google Scholar : PubMed/NCBI

5 

Huang J, Mao Y, Wang Y, Zhang ZJ, Zhao MG and Liu Y: Modernization of the organ transplantation program in China. Transplantation. 86:1649–1652. 2008. View Article : Google Scholar : PubMed/NCBI

6 

Huang J, Millis JM, Mao Y, Millis MA, Sang X and Zhong S: A pilot programme of organ donation after cardiac death in China. Lancet. 379:862–865. 2012. View Article : Google Scholar : PubMed/NCBI

7 

Terasaki PI, Cecka JM, Gjertson DW and Takemoto S: High survival rates of kidney transplants from spousal and living unrelated donors. New Engl J Med. 333:333–336. 1995. View Article : Google Scholar

8 

Avlonitis VS, Wigfield CH, Golledge HD, Kirby JA and Dark JH: Early hemodynamic injury during donor brain death determines the severity of primary graft dysfunction after lung transplantation. Am J Transplant. 7:83–90. 2007. View Article : Google Scholar : PubMed/NCBI

9 

Stiegler P, Sereinigg M, Puntschart A, et al: Oxidative stress and apoptosis in a pig model of brain death (BD) and living donation (LD). J Transl Med. 11:2442013. View Article : Google Scholar : PubMed/NCBI

10 

Avlonitis VS, Wigfield CH, Kirby JA and Dark JH: The hemodynamic mechanisms of lung injury and systemic inflammatory response following brain death in the transplant donor. Am J Transplant. 5:684–693. 2005. View Article : Google Scholar : PubMed/NCBI

11 

Rostron AJ, Avlonitis VS, Cork DM, Grenade DS, Kirby JA and Dark JH: Hemodynamic resuscitation with arginine vasopressin reduces lung injury after brain death in the transplant donor. Transplantation. 85:597–606. 2008. View Article : Google Scholar : PubMed/NCBI

12 

Leber B, Stadlbauer V, Stiegler P, et al: Effect of oxidative stress and endotoxin on human serum albumin in brain-dead organ donors. Transl Res. 159:487–496. 2012. View Article : Google Scholar : PubMed/NCBI

13 

Vespa PM: Hormonal dysfunction in neurocritical patients. Curr Opin Crit Care. 19:107–112. 2013. View Article : Google Scholar

14 

Ranasinghe AM and Bonser RS: Endocrine changes in brain death and transplantation. Best Pract Res Clin Endocrinol Metab. 25:799–812. 2011. View Article : Google Scholar

15 

Hvas CL, Fenger-Eriksen C, Høyer S, Sørensen B and Tønnesen E: Hypercoagulation following brain death cannot be reversed by the neutralization of systemic tissue factor. Thromb Res. 132:300–306. 2013. View Article : Google Scholar : PubMed/NCBI

16 

Wu X, Du Z, Yu J, et al: Activity of factor VIII in patients with isolated blunt traumatic brain injury: association with coagulopathy and progressive hemorrhagic injury. J Trauma Acute Care Surg. 76:114–120. 2014. View Article : Google Scholar : PubMed/NCBI

17 

Kuecuek O, Mantouvalou L, Klemz R, et al: Significant reduction of proinflammatory cytokines by treatment of the brain-dead donor. Transplant Proc. 37:387–388. 2005. View Article : Google Scholar : PubMed/NCBI

18 

Nijboer WN, Schuurs TA, van der Hoeven JA, et al: Effects of brain death on stress and inflammatory response in the human donor kidney. Transplant Proc. 37:367–369. 2005. View Article : Google Scholar : PubMed/NCBI

19 

Koudstaal LG, ‘t Hart NA, Ottens PJ, et al: Brain death induces inflammation in the donor intestine. Transplantation. 86:148–154. 2008. View Article : Google Scholar : PubMed/NCBI

20 

Auråen H, Mollnes TE, Bjørtuft Ø, et al: Multiorgan procurement increases systemic inflammation in brain dead donors. Clin Transplant. 27:613–618. 2013.PubMed/NCBI

21 

Ignatova M, Guével B, Com E, et al: Two-dimensional fluorescence difference gel electrophoresis analysis of Listeria monocytogenes submitted to a redox shock. J Proteomics. 79:13–27. 2013. View Article : Google Scholar

22 

Qiao B, Wang J, Xie J, et al: Detection and identification of peroxiredoxin 3 as a biomarker in hepatocellular carcinoma by a proteomic approach. Int J Mol Med. 29:832–840. 2012.PubMed/NCBI

23 

Pratschke J, Wilhelm MJ, Kusaka M, Laskowski I and Tilney NL: A model of gradual onset brain death for transplant-associated studies in rats. Transplantation. 69:427–430. 2000. View Article : Google Scholar : PubMed/NCBI

24 

Van Der Hoeven JA, Moshage H, Schuurs T, Nijboer M, Van Schilfgaarde R and Ploeg RJ: Brain death induces apoptosis in donor liver of the rat. Transplantation. 76:1150–1154. 2003.PubMed/NCBI

25 

Sereinigg M, Stiegler P, Puntschart A, et al: Establishing a brain-death donor model in pigs. Transplant Proc. 44:2185–2189. 2012. View Article : Google Scholar : PubMed/NCBI

26 

Weiss S, Kotsch K, Francuski M, et al: Brain death activates donor organs and is associated with a worse I/R injury after liver transplantation. Am J Transplant. 7:1584–1593. 2007. View Article : Google Scholar : PubMed/NCBI

27 

Golling M, Jahnke C, Fonouni H, et al: Distinct effects of surgical denervation on hepatic perfusion, bowel ischemia, and oxidative stress in brain dead and living donor porcine models. Liver Transpl. 13:607–617. 2007. View Article : Google Scholar

28 

Lau A, Arundine M, Sun HS, Jones M and Tymianski M: Inhibition of caspase-mediated apoptosis by peroxynitrite in traumatic brain injury. J Neurosci. 26:11540–11553. 2006. View Article : Google Scholar : PubMed/NCBI

29 

Pérez López S, Vázquez Moreno N, Escudero Augusto D, et al: A molecular approach to apoptosis in the human heart during brain death. Transplantation. 86:977–982. 2008.PubMed/NCBI

30 

Giambra V, Jenkins CR, Wang H, et al: NOTCH1 promotes T cell leukemia-initiating activity by RUNX-mediated regulation of PKC-θ and reactive oxygen species. Nat Med. 18:1693–1698. 2012.PubMed/NCBI

Related Articles

  • Abstract
  • View
  • Download
  • Twitter
Copy and paste a formatted citation
Spandidos Publications style
Du B, Li L, Zhong Z, Fan X, Qiao B, He C, Fu Z, Wang Y and Ye Q: Brain death induces the alteration of liver protein expression profiles in rabbits. Int J Mol Med 34: 578-584, 2014.
APA
Du, B., Li, L., Zhong, Z., Fan, X., Qiao, B., He, C. ... Ye, Q. (2014). Brain death induces the alteration of liver protein expression profiles in rabbits. International Journal of Molecular Medicine, 34, 578-584. https://doi.org/10.3892/ijmm.2014.1806
MLA
Du, B., Li, L., Zhong, Z., Fan, X., Qiao, B., He, C., Fu, Z., Wang, Y., Ye, Q."Brain death induces the alteration of liver protein expression profiles in rabbits". International Journal of Molecular Medicine 34.2 (2014): 578-584.
Chicago
Du, B., Li, L., Zhong, Z., Fan, X., Qiao, B., He, C., Fu, Z., Wang, Y., Ye, Q."Brain death induces the alteration of liver protein expression profiles in rabbits". International Journal of Molecular Medicine 34, no. 2 (2014): 578-584. https://doi.org/10.3892/ijmm.2014.1806
Copy and paste a formatted citation
x
Spandidos Publications style
Du B, Li L, Zhong Z, Fan X, Qiao B, He C, Fu Z, Wang Y and Ye Q: Brain death induces the alteration of liver protein expression profiles in rabbits. Int J Mol Med 34: 578-584, 2014.
APA
Du, B., Li, L., Zhong, Z., Fan, X., Qiao, B., He, C. ... Ye, Q. (2014). Brain death induces the alteration of liver protein expression profiles in rabbits. International Journal of Molecular Medicine, 34, 578-584. https://doi.org/10.3892/ijmm.2014.1806
MLA
Du, B., Li, L., Zhong, Z., Fan, X., Qiao, B., He, C., Fu, Z., Wang, Y., Ye, Q."Brain death induces the alteration of liver protein expression profiles in rabbits". International Journal of Molecular Medicine 34.2 (2014): 578-584.
Chicago
Du, B., Li, L., Zhong, Z., Fan, X., Qiao, B., He, C., Fu, Z., Wang, Y., Ye, Q."Brain death induces the alteration of liver protein expression profiles in rabbits". International Journal of Molecular Medicine 34, no. 2 (2014): 578-584. https://doi.org/10.3892/ijmm.2014.1806
Follow us
  • Twitter
  • LinkedIn
  • Facebook
About
  • Spandidos Publications
  • Careers
  • Cookie Policy
  • Privacy Policy
How can we help?
  • Help
  • Live Chat
  • Contact
  • Email to our Support Team