International Journal of Molecular Medicine is an international journal devoted to molecular mechanisms of human disease.
International Journal of Oncology is an international journal devoted to oncology research and cancer treatment.
Covers molecular medicine topics such as pharmacology, pathology, genetics, neuroscience, infectious diseases, molecular cardiology, and molecular surgery.
Oncology Reports is an international journal devoted to fundamental and applied research in Oncology.
Experimental and Therapeutic Medicine is an international journal devoted to laboratory and clinical medicine.
Oncology Letters is an international journal devoted to Experimental and Clinical Oncology.
Explores a wide range of biological and medical fields, including pharmacology, genetics, microbiology, neuroscience, and molecular cardiology.
International journal addressing all aspects of oncology research, from tumorigenesis and oncogenes to chemotherapy and metastasis.
Multidisciplinary open-access journal spanning biochemistry, genetics, neuroscience, environmental health, and synthetic biology.
Open-access journal combining biochemistry, pharmacology, immunology, and genetics to advance health through functional nutrition.
Publishes open-access research on using epigenetics to advance understanding and treatment of human disease.
An International Open Access Journal Devoted to General Medicine.
Breast cancer is a significant health concern amongst females. Gene therapy as a treatment for cancer has received increasing attention following the development of efficient molecular techniques (1,2). Studies have demonstrated that the development of novel blood vessels surrounding tumors provide nutrition and remove metabolic products, which promotes tumor growth and induces tumor metastasis (3). Inhibition of angiogenesis results in the apoptosis or necrosis of tumor cells (4). Angiogenesis inhibitors target vascular endothelial cells, which are genetically stable and invulnerable to mutation (5). In addition, endogenous angiogenesis inhibitors are highly selective and specifically inhibit the proliferation of endothelial cells within lesions (6). Therefore, the use of such inhibitors has become an effective strategy for the treatment of various types of cancer (7).
Tumstatin was discovered as an endogenous angiogenesis inhibitor, exhibiting marked anti-tumor activity in 2003 (8). Tumstatin exerts its effects by inhibiting protein synthesis in vascular endothelial cells and inducing apoptosis, thereby inhibiting angiogenesis. In addition, tumstatin inhibits the proliferation of tumor cells and promotes their apoptosis (9,10). Furthermore, tumstatin is able to inhibit tumor growth and the associated pathological angiogenesis without affecting physiological angiogenesis (11).
Studies regarding the safety and effectiveness of active fragments of tumstatin have attracted attention worldwide as tumstatin was demonstrated to be a pathogenic antigen with a high molecular weight, which may result in glomerulonephritis and lung hemorrhage (12). In previous studies by our group, amino acids 185–203 at the C terminus were successfully transformed into the T21 peptide, which demonstrated anti-angiogenic activity, and amino acids 75–95 at the N-terminus were transformed into the T19 peptide, which exhibited anti-cancer activity. The lower molecular weights of these fragments reduced the immunogenicity and improved the safety of tumstatin. The T21 peptide was subsequently reconstructed with the arginylglycylaspartic acid (RGD)-peptide sequence, which was shown to inhibit the proliferation and migration of tumor cells. The two active fragments of tumstatin, T21RGD and T19 peptide, were ligated via a soft linker to form the recombinant T42 peptide, which was constructed based on previous studies (13,14). The activity of the constructed peptide was hypothesized to be higher than that of any of the single fragments used in previous studies. Previous studies demonstrated that the tumstatin-associated T42 and quadruple (4x)T42 peptide had significant anti-tumor activity (15,16) and inhibited the growth and proliferation of the human cancer cell line HepG2 while promoting apoptosis (9).
An adenovirus is a non-integrated double-stranded DNA virus which is widely distributed throughout nature. Although certain types of adenovirus cause acute gastrointestinal, pulmonary or eye infection in humans (17), the adenovirus used in gene therapy is comparatively safe and carries a low risk of pathogenesis, teratogenesis or carcinogenesis. As the most widely used vector in clinical trials for gene therapy, the adenoviral vector has also been extensively used in research. Adenovirus-mediated gene therapy is conventionally conducted in vivo (18,19).
In previous experiments by our group, purified T42 peptide was applied to MCF-7 cells in vitro. T42 was found to have an anti-tumor effect (data is not shown); however, the metabolic rate of such small molecular proteins in the body was so rapid that high, repeated doses were required. Therefore, it was hypothesized that expression of the 4xT42 peptide gene may also have anti-tumor effects and circumvent the requirement for high, repeated doses. In the present study, it was demonstrated for the first time, to the best of our knowledge, that adenoviral vectors containing the T42 or quadruple T42 (4xT42) genes had antitumor activity. By artificially synthesizing the T42 peptide gene, the adenoviral vectors plasmid adenovirus-enhanced green fluorescent protein-T42 (pAd-EGFP-T42) and pAd-EGFP-4xT42 were successfully constructed using the isocaudarner ligation technique. Subsequently, 293 cells were infected with pAd-EGFP-T42 and pAd-EGFP-4xT42. To confirm the expression of the T42 and 4xT42 genes, GFP expression levels were monitored by fluorescence microscopy and the expression of T42 was assessed by reverse transcription polymerase chain reaction (RT-PCR). The anti-cancer effects of pAd-EGFP-T42/pAd-EGFP-4xT42 on breast cancer cells in vitro as well as in vivo were also preliminarily investigated. In addition, the mechanism underlying the anticancer activity was further investigated.
The human embryonic kidney 293 cell line and the human breast cancer cell line MCF-7 were obtained from the American Type Culture Collection (Manassas, VA, USA). The cells were maintained in Dulbecco’s modified Eagle’s medium (DMEM; Invitrogen Life Technologies, Carlsbad, CA, USA) supplemented with 10% fetal bovine serum (FBS; Sijiqing Biological Engineering Materials Co., Hangzhou, China) at 37°C in 5% CO2. Female BALB/c immunodeficient nude mice that were 6–8 weeks old and weighed 18–20 g were used. The mice were maintained under controlled conditions of humidity (50 ± 10%), light (12/12 h light/dark cycle) and temperature (23 ± 2°C), had ad libitum access to water and were fed a pelleted basal diet. All animal handling and experimental procedures were performed in accordance with the Guide for the Care and Use of Laboratory Animals published by the National Institutes of Health (NIH Published No. 85-23, revised 1996; Bethesda, MA, USA). The present study was approved by the Medical Ethics Committee of Heilongjiang province (Daqing, China),
The T42 gene was synthesized artificially according to the reference sequence of protein MPFLFCNVNDVCNFASRGDYSGGASPFLECHGRGTCN YYSNS (AXYBIO BIO-TECH CO., Changsha, China). Recognition sites for the restriction enzymes BamHI and BglII-EcoRI were added to the 5′ and 3′ ends of the sequence, respectively. PCR followed by restriction digestion and subsequent clone screening was used to generate pEC3.1(+)-EGFP-T42 and pEC3.1(+)-EGFP-4xT42 from the recombinant plasmids pEC3.1(+)-T42 and pEC3.1(+)-4xT42. The pAd-EGFP-T42, pAd-EGFP-4xT42 and pAd-EGFP plasmids were constructed by transferring the EGFP-4xT42, EGFP-T42 and EGFP expression cassettes into pAd-BL-Dest adenoviral vectors (Invitrogen Life Technologies) using homologous recombination in vitro by LR reaction (20). The vector was then linearized by single enzyme digestion with restriction endonuclease Pac I (New England Biolabs, Inc., Ipswich, MA, USA) for transfection. The linearized vector was transfected into 293 cells and the GFP expression levels were examined to determine whether the pAd)-EGFP-T42, pAd-EGFP-4xT42 and pAd-EGFP had been successfully recombined. The successfully transfected 293 cells were collected when a marked cytopathogenic effect was observed and >50% of the cells were floating. The cells were subjected to three rounds of freeze-thaw cycles and centrifugation at 12,000 × g for 10 min at 4°C, and the viral fluid was collected. The adenovirus was purified using the Adenovirus Purification Maxi kit (ClonTech Laboratories, Inc., Mountain View, CA, USA). RT-PCR was subsequently used to determine the viral load (20), using a kit purchased from Takara Bio, Inc. (Otsu, Japan). To measure the viral titer, 20 μl viral sample was serially diluted and cultivated for two days in a 24-well plate. The number of cells expressing GFP fluorescence was counted under a fluorescence microscope (Nikon-TE2000-U; Nikon Corporation, Tokyo, Japan). The viral titer was calculated using the following equation: (Number of cells with fluorescence) × (dilution factor)/(quantity of viruses inoculated).
The plaque assay utilized a confluent monolayer of 293 cells plated in six-well plates (NEST Science Co., Ltd., Shanghai, China). The samples were subjected to ten-fold serial dilutions in DMEM containing glutamine, 5% heat-inactivated FBS and 0.05% gentamicin (Invitrogen Life Technologies). Diluted samples (0.2 ml) were added to each well of cells in duplicate or triplicate. Following sample inoculation, the plates were placed in an incubator (Thermo Scientific 3111; Thermo Fisher Scientific, Waltham, MA, USA) for 1 h at 37°C with 5% CO2. Every 15 min, the plates were agitated, allowing the sample dilution to move over the monolayer and ensuring full coverage by the inoculum. Following 1 h of incubation, the wells were covered with 2 ml 1:1 primary overlay comprising 1% agarose (SeaKem ME; 0.5% final concentration) and 2X basal medium Eagle with Earle’s salts [4-(2-hydroxyethyl)-1-piperazineethanesulfonic acid, 10% FBS and 0.05% gentamicin]. The plates were incubated at 37°C with 5% CO2 for seven days. At seven days post-inoculation, 2 ml secondary staining overlay [primary overlay and 5% Neutral Red stain (Santa Cruz Biotechnology, Inc., Dallas, TX, USA)] was added to each well. At 24 and 48 h, the plaques were counted to determine the sample viral titer in plaque forming units (Pfu)/ml. The minimum detection limit of the plaque assay was calculated as <1.666 Pfu based on the observation of one plaque out of three replicates (average=0.333) counted in a sample of 0.2 ml virus added to cells. The maximum detection limit in the current format was >5×108 Pfu/ml [based on the observation of more than 100 plaques in the replicates of the six-fold dilution (100×5×106)].
MCF-7 cells were seeded into 24-well plates at 5×104 cells/well. pAd-EGFP-T42, pAd-EGFP-4xT42 or pAd-EGFP was added at MOIs of 0, 25, 50, 100 and 200, respectively (six wells for each MOI). Following 4 h of incubation, cells were washed twice with 500 μl PBS prior to the addition of 500 μl DMEM containing 10% FBS to each well. Following 24 h of further incubation, the transduction efficiency was evaluated by observing the expression of eGFP.
Four groups were evaluated in the present study: pAd-EGFP-T42, pAd-EGFP-4xT42, pAd-EGFP control and a blank control group. At 24 h prior to infection, MCF-7 cells that were in an exponential growth phase were plated in six-well plates at a density of 4×105 cells/well. The following day, the cells in each group were transfected and incubated for 18 h. Following incubation, the success of transfection was evaluated by examination of the cells under a fluorescence microscope (Nikon-TE2000-U), and the cells in each group were transferred to 96-well plates at a density of 2×104 cells/well with an MOI of 100. An MTT assay was subsequently conducted in each group of cells at 12, 24, 36 and 48 h following transfection. To perform the MTT assay, 25 μl fresh MTT (5 mg/ml; Sigma-Aldrich, St Louis, MO, USA) was added to each well. The cells were then incubated at 37°C for 4 h to allow the incorporation and conversion of MTT to the formazan derivative. The formazan derivative was solubilized by the addition of 100 μl DMSO (Sigma-Aldrich). The absorbance values were measured at 570 nm using an EXL808 plate reader (Bio-Tek Instruments, Inc., Winooski, VT, USA).
MCF-7 cells were prepared and separated into four groups according to an identical protocol to that of the MTT assay. Twenty-four hours following confirmation of transfection, 100 MOI recombinant adenovirus or control pAd-EGFP adenovirus was added to each well and the plates were incubated for 4 h at 37°C and 5% CO2. The cells were then resuspended in ice-cold 70% ethanol and stored at −20°C prior to analysis. The cellular DNA was stained with PBS containing 100 μg/ml propidium iodide (Beyotime Institute of Biotechnology, Nantong, China), 0.6% Nonidet P-40 and 100 μg/ml RNase A (Beyotime Institute of Biotechnology). The samples (105) were analyzed using a FACS BD Aria flow cytometer at 488 nm (BD Biosciences, Franklin Lakes, NJ, USA). Ten thousand cells were analyzed using three replicates. The results were analyzed using the FACSDiva™ version 6.1.1 (BD Biosciences) software.
MCF-7 cells were inoculated in six-well plates at 4×105 cells/well and treated as aforementioned. A lysis buffer [150 mmol/l NaCl, 1% NP-40, 0.02% sodium azide, 10 μg/ml phenylmethanesulfonylfluoride and 50 mmol/l Tris-HCl (pH 8.0)] was added to the cells at 150 μl per tube. The lysate was incubated on ice for 30 min and centrifuged at 12,000 xg for 4 min at 4°C. The supernatant was collected and the protein concentration was analyzed using a bicinchoninic acid protein assay kit (Beyotime Institute of Biotechnology). Subsequently, western blot analysis was performed. Briefly, protein samples were electrophoresed by 10% SDS-PAGE and transferred onto a nitrocellulose membrane (Millipore, Billerica, MA, USA). The membrane was incubated in fresh blocking buffer at room temperature for 1 h and then probed with the following antibodies [all diluted at 1:1,000, v/v; Beyotime Institute of Biotechnology): Mouse anti-human polyclonal β-actin, mouse anti-human polyclonal anti-caspase-3, mouse anti-human monoclonal anti-B-cell lymphoma 2 (Bcl-2) and rabbit anti-human polyclonal Bcl-2-associated X protein in blocking buffer [0.1% (v/v) Tween 20 in Tris-buffered saline, pH 7.4, containing 5% (w/v) skimmed milk] at 4°C overnight. Following washing three times with Tris-buffered saline containing 0.1% (v/v) Tween 20 (TBST) buffer for 5 min each, the membrane was incubated with the appropriate horseradish peroxidase-conjugated secondary antibody [goat anti-mouse immunoglobulin G (IgG), 1:5,000; Kangchen Biotechnology, Shanghai, China and goat anti-rabbit IgG, 1:2,000; Santa Cruz Biotechnology, Inc. Dallas, TX, USA] at room temperature for 1 h and then washed again three times in TBST buffer. The membrane was incubated with enhanced chemiluminescence substrate solution (Santa Cruz Biotechnology, Inc.) for 5 min according to the manufacturer’s instructions prior to visualization with autoradiography film (Bio-Rad ChemiDoc XRS; Bio-Rad Laboratories, Hercules, CA, USA).
MCF-7 cells in the exponential phase of growth were adjusted to a density of 5×107 cells/ml. Mice were inoculated subcutaneously in the right breast fat pad with 0.1 m1 MCF-7 cell suspension and a 10-mm3 (volume=long diameter × short diameter2 × π/6) tumor formed ~two weeks subsequently. The nude mice were divided randomly into four groups of ten mice. Then, 1.0×109 Pfu/kg pAd-EGFP-T42, pAd-EGFP-4xT42 or pAd-EGFP was injected locally into the tumor on days one, five and ten. For the control group, PBS (0.1 ml total) was injected locally into the tumor on an identical treatment schedule. The tumor was dissected for measurement 28 days after the first injection and the growth inhibition ratio of the tumor was calculated using the following equation: Growth inhibition ratio of the tumor=[1−(size of tumor of each group on day 28-size on day 0)/(size of tumor of the blank control group on day 28-size on day 0)] ×100%.
The entire tumor was embedded in paraffin. Paraffin sections were subsequently dewaxed and antigen retrieval was performed by incubating the sections in 0.01 mol/l citrate buffer (pH 6.0) at 92–98°C. The sections were then incubated in 0.05% trypsin (Beyotime Institute of Biotechnology) at 37°C for 30 min followed by incubation in 3% H2O2 (Beyotime Institute of Biotechnology) for 10 min. Primary labeling was conducted using mouse anti-human CD34 monoclonal antibody (Sigma-Aldrich) at a dilution of l:100 at 4°C overnight. Following rewarming of the sections, the secondary antibody was added to the slides followed by 3,3′-diaminobenzidine for a color reaction. The sections were subsequently stained with hematoxylin. PBS was used in place of the primary antibody as a negative control. To quantify the vascular area, three areas of high vascular density were selected at low magnification (×40) and the microvessels were quantified in each region at high magnification (×200). The average for each section was considered to indicate the microvascular density.
Values are presented as the mean of ≥three independent experiments ± standard deviation unless otherwise stated. An unpaired Student’s t-test or analysis of variance was used to determine the significance of differences between experimental groups. The statistical analyses were performed using SPSS version 13.0 software (SPSS Inc., Chicago, IL, USA). P<0.05 was considered to indicate a statistically significant difference between values.
The pAd-EGFP-T42 and pAd-EGFP-4xT42 plasmid DNA was extracted and digested using Pac I. Following Pac I digestion, the fragment sizes were determined as 3,000 bp and >15 kb, which confirmed that the plasmid backbone was pAd-BL-dest and that the pAd-EGFP-T42 and pAd-EGFP-4xT42 inserts were correct (20).
Following 24 h of transfection with pAd (empty vector), pAd-EGFP-T42 or pAd-EGFP-4xT42, the virus demonstrated a cytopathic effect on the transfected 293 cells and EGFP was successfully identified by fluorescent microscopy (Fig. 1). Consistent with these results, RT-PCR of the pAd-EGFP-T42 and pAd-EGFP-4xT42 adenoviruses indicated that T42/4xT42 was expressed following transfection. The virus titer of the 293 cells was also measured at 5×109 Pfu/ml.
The cell growth inhibition rate was significantly enhanced in the pAd-EGFP-T42 and pAd-EGFP-4xT42 transfection groups compared with that of the control group at 36 and 48 h (P<0.05). However, there was no significant difference in the cell growth inhibition rate between the pAd-EGFP plasmid transfection group and that of the control group at any time-point (Fig. 2).
The results of the flow cytometric analysis of apoptosis are exhibited in Fig. 3. The apoptotic rates of the blank control, pAd-EGFP, pAd-EGFP-T42 and pAd-EGFP-4xT42 groups were 11.82±2.31, 14.86±1.02, 39.38±2.17 and 42.29±3.26%, respectively. The apoptotic rates of the MCF-7 cells infected with pAd-EGFP-T42 or pAd-EGFP-4xT42 were significantly higher than those of the cells infected with the control adenovirus and the non-transfected cells in the blank control group (P<0.05). There was no significant difference in the apoptotic rate of the control group and that of the pAd-EGFP group (P>0.05) or between that of the pAd-EGFP-T42 group and that of the pAd-EGFP-4xT42 group.
Western blot analysis was used to evaluate the expression levels of apoptosis-associated proteins in MCF-7 cells treated with pAd-EGFP-T42 and pAd-EGFP-4xT42. As indicated in Fig. 4, expression levels of Bcl-2 were significantly decreased, while expression levels of Bax were significantly enhanced in MCF-7 cells treated with pAd-EGFP-T42 and pAd-EGFP-4xT42 in comparison to those of the control and pAd-EGFP groups. The levels of the active 17 kDa cleaved caspase-3 fragment were significantly increased in MCF-7 cells transfected with pAd-EGFP-T42 and pAd-EGFP-4xT42, compared with those of the control and pAd-EGFP groups.
Mice were sacrificed by cervical dislocation 28 days after injection of adenovirus, and the tumors were excised for measurement. The average tumor sizes in each of the four groups were 122.46±8.08, 113.28±6.37, 63.32±13.10 and 54.86±13.59 mm3, respectively. The inhibition rates of tumor growth are presented in Fig. 5. There was a significant increase in the tumor growth inhibition rate of the pAd-EGFP-T42- and pAd-EGFP-4xT42-transfected groups and that of the control group (P<0.05). There was also a significant increase in the tumor growth inhibition rate of the pAd-EGFP-4xT42 group compared to that of the pAd-EGFP group (P<0.05).
Irregular neovascularization was detected in the tumor tissue, in particular at the edge of the tumor, by immunohistochemical staining. In the tumors of the mice infected with pAd-EGFP-T42 and pAd-EGFP-4xT42, there was a decreased microvessel density compared to that of the tumors of the mice transfected with pAd-EGFP. The results of the microvessel count are presented in Table I and Fig. 6.
In 2000, Maeshima et al (10) reported that tumstatin was able to selectively inhibit the angiogenesis of tumor tissue, without influencing normal angiogenesis. Tumstatin has been described as an endogenous antitumor agent (11,21). Amino acids 54–132 at the N-terminus of the protein have demonstrated anti-angiogenic effects, while amino acids 185–203 at the C-terminus have displayed antitumor activity (21).
Through binding with αVβ3 integrin, tumstatin inhibits activation of the transduction pathway involving focal adhesion kinase, phosphatidylinositol-4,5-bisphosphate 3-kinase and Akt and the mammalian target of rapamycin pathway (22). As a result, tumstatin prevents the dissociation of eukaryotic initiation factor 4E protein from 4E-binding protein 1, which leads to the inhibition of cap-dependent protein synthesis in endothelial cells (23). Twenty-one peptides function to preserve the anti-angiogenic activity of tumstatin (24). Studies have also demonstrated that 19 peptides are involved in the inhibition of adhesion, chemotaxis and proliferation of various cells by binding to the CD47/integrin-associated protein and αvβ3 proteins on the surface of tumor cells and forming a complex (25). In the present study, the 19-residue tumstatin peptide, a fragment with antitumor activity, and the 21-residue peptide were ligated. The RGD structure was also added, as well as amino acids -GG-, to form a 21 peptide-GG-19 peptide construct, which consisted of 42 peptides in total. RGD has been shown to inhibit the proliferation and migration of tumor cells and was therefore predicted to increase the antitumor capability of the 42-residue peptide (26). These small peptides from tumstatin promoted cell apoptosis via extracellular effects. However, to the best of our knowledge, it had not previously been elucidated whether the tumstatin T42 peptide was able to influence the intracellular activity of tumor cells. Therefore, in the present study, eukaryotic cells were infected with an adenovirus carrying the target gene and the expression levels of target proteins in these eukaryotic cells were subsequently evaluated. In addition, the antitumor effects of the T42 peptide were further examined by infecting breast cancer cells with an adenovirus carrying the T42 target gene.
The adenovirus Ad5, selected for use in the present study, has been improved by advancements in biotechnology. The Ad5 genome cannot produce the packaging protein E1 unless it is provided by the host 293 cells; therefore, its genome is able to be amplified in 293 cells (27). However, normal human tissue cells do not express the E1 protein; therefore, the packaging protein E1 of Ad5 will not be present and the virus will be unable to proliferate in human cells (28). The virus is capable of being engineered to produce a specific target protein, so it is safe for use in gene therapy research (29). Following the construction of the adenoviral vector containing the T42 or 4xT42 gene coupled with EGFP, GFP was observed using fluorescence microscopy, which confirmed that the EGFP fragment had been successfully incorporated into the 293 cells. RT-PCR verified that the T42 and 4xT42 plasmid were expressed by 293 cells. Furthermore, the fluorescence observed following transfection indicated that the adenoviruses were successfully packaged and transfected effectively. At seven days post-transfection, a large proportion of the 293 cells shed and appeared disintegrated under microscopic examination, which was consistent with previous studies (30). When transfections are performed without the use of a fluorescent indicator, the amount of time in which viruses are produced is difficult to accurately determine. By contrast, in the present study, it was ensured that the maximum viral titer and conditions for viral amplification were optimized.
The successful construction and packaging of the pAd-EGFP-T42 and pAd-EGFP-4xT42 adenoviruses and the preliminary results regarding their function indicated that the adenovirus promoted apoptosis and inhibited the growth of cancer cells, which provided a foundation for further investigation into gene therapies for cancer. The growth inhibition ratios of the transfected groups compared to those of the control group at four different time-points were calculated using the MTT assay. The results of these experiments demonstrated that no significant inhibitory effect of the pAd-EGFP-T42 and pAd-EGFP-4xT42s plasmid on the growth inhibition rate was evident at 12 or 24 h in comparison to that of the control group. However, the inhibitory effect increased over time, and at 36 and 48 h there was a significant difference between the growth inhibition rate of pAd-EGFP-T42 and pAd-EGFP-4xT42 plasmid groups and that of the control group (P<0.05), while there was no significant difference between that of the pAd-EGFP plasmid group and that of the control group.
Flow cytometry was used to determine the apoptotic rates of the cells in the recombinant adenovirus pAd-EGFP-T42 and pAd-EGFP-4xT42 groups, the pAd-EGFP adenovirus control group and the blank control group. The apoptotic rates of the cells infected with pAd-EGFP-T42 and pAd-EGFP-4xT42 were significantly higher than those of the cells infected with the control adenovirus or the non-transfected cells in the blank control group (P<0.05). These results demonstrated that transfection of pAd-EGFP-T42 and pAd-EGFP-4xT42 were able to significantly enhance the apoptotic rate of tumor cells at 48 h post-transfection, which was consistent with the results of the MTT assay.
The results of the present study revealed that pAd-EGFP-T42 and pAd-EGFP-4xT42 suppressed the growth of MCF-7 cells in vitro and the growth of tumor xenografts in vivo. In MCF-7 cells treated with pAd-EGFP-T42 or pAd-EGFP-4xT42, there was significant downregulation of Bcl-2 expression and upregulation of Bax and caspase-3 expression, which are key executors during apoptosis. These results indicated that the mitochondrial pathway may be involved in regulating the induction of apoptosis (31). There are distinct mechanisms that mediate the anti-angiogenic and antiproliferative activities of these tumstatin peptides. Mice treated with pAd-EGFP-T42 or pAd-EGFP-4xT42 had fewer CD34-positive vessels. The results observed were similar to those of previous reports indicating that the 19 peptide fragments were able to inhibit tumor proliferation and the 21 peptide fragments were able to inhibit endothelial cell proliferation. Therefore, the recombinant adenovirus packaged in the present study had both abilities.
Recombinant adenoviruses carrying the T42 or 4xT42 genes (pAd-EGFP-T42/pAd-EGFP-4xT42) were successfully constructed. The results of the present study revealed that the adenoviruses constructed were able to inhibit the proliferation of breast cancer cells in vivo and in vitro. Of note, no significant difference was observed between the pAd-EGFP-T42- and the pAd-EGFP-4xT42-transfected groups. pAd-EGFP-T42 and pAd-EGFP-4xT42 may function via the mitochondrial pathway to inhibit transplant tumor angiogenesis. The adenoviral constructs exhibited antitumor effects when the peptide was expressed in the cells in vitro, and also upon the expression of the peptide gene by the recombinant virus in vivo. However, the target of the T42 peptide remains to be elucidated. In conclusion, the results of the present study indicated the relevance of the T42 peptide in the development of novel cancer treatment strategies, which requires further study in order to elucidate the mechanism of the antitumor effects of this adenovirus.
The authors would like to thank the Science and Technology Funds of the Hei Longjiang Education Department of China for the grant they provided to support the present study (no. 12511188).
|
CPE |
cytopathic effect |
|
DMEM |
Dulbecco’s modified Eagle’s medium |
|
DMSO |
dimethyl sulfoxide |
|
EGFP |
enhanced green fluorescent protein |
|
FBS |
fetal bovine serum |
|
MOI |
multiplicity of infection |
|
MVD |
microvascular density |
|
PBS |
phosphate-buffered saline |
|
Pfu |
plaque-forming unit |
|
RT-PCR |
reverse-transcription polymerase chain reaction |
|
Tazawa H, Kagawa S and Fujiwara T: Advances in adenovirus-mediated p53 cancer gene therapy. Expert Opin Biol Ther. 13:1569–1583. 2013. View Article : Google Scholar : PubMed/NCBI | |
|
Liu SX, Xia ZS and Zhong YQ: Gene therapy in pancreatic cancer. World J Gastroenterol. 20:13343–13368. 2014. View Article : Google Scholar : PubMed/NCBI | |
|
Folkman J: Tumour angiogenesis: therapeutic implications. N Engl J Med. 285:1182–1186. 1971. View Article : Google Scholar : PubMed/NCBI | |
|
Hlatky L, Hahnfeldt P and Folkman J: Clinical application of antiangiogenic therapy: microvessel density, what it does and doesn’t tell us. J Natl Cancer Inst. 94:883–893. 2002. View Article : Google Scholar : PubMed/NCBI | |
|
Albig AR and Schiemann WP: Fibulin-5 antagonizes vascular endothelial growth factor (VEGF) signaling and angiogenic sprouting by endothelial cells. DNA Cell Biol. 23:367–379. 2004. View Article : Google Scholar : PubMed/NCBI | |
|
Sim BK: Angiostatin and endostatin: endothelial cell-specific endogenous inhibitors of angiogenesis and tumor growth. Angiogenesis. 2:37–48. 1998. View Article : Google Scholar | |
|
Ribatti D: History of research on angiogenesis. Chem Immunol Allergy. 99:1–14. 2014. View Article : Google Scholar | |
|
Hamano Y, Zeisberg M, Sugimoto H, et al: Physiological levels of tumstatin, a fragment of collagen IV alpha3 chain, are generated by MMP-9 proteolysis and suppress angiogenesis via alphaVbeta3 integrin. Cancer Cell. 3:589–601. 2003. View Article : Google Scholar : PubMed/NCBI | |
|
Su XJ, Wu FJ, Yuan LJ and Lin XS: Determination of anti-Hepg2 cells activity and purification of tumor chalone T42 peptide. J Jilin Univ, Med Ed. 36:86–89. 2010. | |
|
Maeshima Y, Colorado PC, Torre A, et al: Distinct antitumor properties of a type IV collagen domain derived from basement membrane. J Biol Chem. 275:21340–21348. 2000. View Article : Google Scholar : PubMed/NCBI | |
|
Maeshima Y, Manfredi M, Reimer C, et al: Identification of the anti-angiogenic site within vascular basement membrane-derived tumstatin. J Biol Chem. 276:15240–15248. 2001. View Article : Google Scholar : PubMed/NCBI | |
|
Saus J, Wieslander J, Langeveld JP, Quinones S and Hudson BG: Identification of the Goodpasture antigen as the alpha 3(IV) chain of collagen IV. J Biol Chem. 263:13374–13380. 1988.PubMed/NCBI | |
|
Wang SJ, Liu XH, Ji YB and Chen N: Study on Biological Activity of Two Modified Anti-tumor Peptide of Tumstatin. Biochemistry and Biophysics. 34:1152–1161. 2007.(In Chinese). | |
|
Gao Y, Yu Y, Lu S, Sun BC and Wang XH: Cloning and expression of human tumstatin gene in E. Coli. Chinese Journal of Biochemical Pharmaceutics. 26:324–327. 2005.(In Chinese). | |
|
Li Y, Liu XH, Lin XS, et al: Inhibitory effect of tumstatin related peptide T42 on human umbilical vein endothelial cells and human gastric adenocarcinoma. J Clin Rehab Tissue Engineer Res. 11:1837–1840. 2007.(In Chinese). | |
|
Su XJ, Lin XS, Wu FJ and Yuan LJ: Antitumor activity of tumor chalone 42 peptide combined with cyclophosphamide. China Cancer. 5:334–337. 2010. | |
|
Jones MS II, Harrach B, Ganac RD, et al: New adenovirus species found in a patient presenting with gastroenteritis. J Virol. 81:5978–5984. 2007. View Article : Google Scholar : PubMed/NCBI | |
|
Bernt KM, Ni S, Tieu AT and Lieber A: Assessment of a combined, adenovirus-mediated oncolytic and immunostimulatory tumor therapy. Cancer Res. 65:4343–4352. 2005. View Article : Google Scholar : PubMed/NCBI | |
|
Takehashi M, Kanatsu-Shinohara M, Inoue K, et al: Adenovirus-mediated gene delivery into mouse spermatogonial stem cells. Proc Natl Acad Sci USA. 104:2596–2601. 2007. View Article : Google Scholar : PubMed/NCBI | |
|
Qi DD, Chen YL, Guo JZ, Zhu GM, Zhang T, Jiang S and Wang YZ: Constructiong of recombinant adenovirus vector with 4T42 peptide gene, and study of the effect of anti- SKBR3 cell in vitro. Chinese Journal of Gerontology. 32:2781–2783. 2012.(In Chinese). | |
|
Maeshima Y, Yerramalla UL, Dhanabal M, et al: Extracellular matrix-derived peptide binds to alpha(v)beta(3) integrin and inhibits angiogenesis. J Biol Chem. 276:31959–31968. 2001. View Article : Google Scholar : PubMed/NCBI | |
|
Kawaguchi T, Yamashita Y, Kanamori M, et al: The PTEN/Akt pathway dictates the direct alphaVbeta3-dependent growth-inhibitory action of an active fragment of tumstatin in glioma cells in vitro and in vivo. Cancer Res. 66:11331–11340. 2006. View Article : Google Scholar : PubMed/NCBI | |
|
Maeshima Y, Sudhakar A, Lively JC, et al: Tumstatin, an endothelial cell-specific inhibitor of protein synthesis. Science. 295:140–143. 2002. View Article : Google Scholar : PubMed/NCBI | |
|
Zhang GM, Zhang YM, Fu SB, et al: Effects of cloned tumstatin-related and angiogenesis-inhibitory peptides on proliferation and apoptosis of endothelial cells. Chin Med J (Engl). 121:2324–2330. 2008. | |
|
Shahan TA, Ziaie Z, Pasco S, et al: Identification of CD47/integrin-associated protein and alpha(v)beta3 as two receptors for the alpha3(IV) chain of type IV collagen on tumor cells. Cancer Res. 59:4584–4590. 1999.PubMed/NCBI | |
|
Moreno-Manzano V, Lucio-Cazana J, Konta T, Nakayama K and Kitamura M: Enhancement of TNF-alpha-induced apoptosis by immobilized arginine-glycine-aspartate: involvement of a tyrosine kinase-dependent, MAP kinase-independent mechanism. Biochem Biophys Res Commun. 277:293–298. 2000. View Article : Google Scholar : PubMed/NCBI | |
|
Spector DJ, Halbert DN and Raskas HJ: Regulation of integrated adenovirus sequences during adenovirus infection of transformed cells. J Virol. 36:860–871. 1980.PubMed/NCBI | |
|
Graham FL, Smiley J, Russell WC and Nairn R: Characteristics of a human cell line transformed by DNA from human adenovirus type 5. J Gen Virol. 36:59–74. 1977. View Article : Google Scholar : PubMed/NCBI | |
|
Silman NJ and Fooks AR: Biophysical targeting of adenovirus vectors for gene therapy. Curr Opin Mol Ther. 2:524–531. 2000. | |
|
He TC, Zhou S, da Costa LT, Yu J, Kinzler KW and Vogelstein B: A simplified system for generating recombinant adenoviruses. Pro Natl Acad Sci USA. 95:2509–2514. 1998. View Article : Google Scholar | |
|
Li YJ, Sun LC, He Y, et al: The anti-tumor properties of two tumstatin peptide fragments in human gastric carcinoma. Acta Pharmacol Sin. 30:1307–1315. 2009. View Article : Google Scholar : PubMed/NCBI |